KEGG   Arabidopsis thaliana (thale cress): AT4G01100
Entry
AT4G01100         CDS       T00041                                 

Gene name
ADNT1
Definition
(RefSeq) adenine nucleotide transporter 1
  KO
K14684  solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT4G01100 (ADNT1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AT4G01100 (ADNT1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 827899
NCBI-ProteinID: NP_192019
MIPS: AT4G01100.1
TAIR: AT4G01100
UniProt: O04619 A0A178UTF8
Position
4
AA seq 352 aa
MASEDVKRTESAAVSTIVNLAEEAREGVKAPSYAFKSICKSLFAGGVAGGVSRTAVAPLE
RMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQA
SNGILYMYRQRTGNENAQLTPLLRLGAGATAGIIAMSATYPMDMVRGRLTVQTANSPYQY
RGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGLNFSVYESLKDWLVKENPYGLVENN
ELTVVTRLTCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASAIVTGEGRSTASLEYTGMV
DAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVEFRISD
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggcatcagaggatgtgaaaagaacagaatcagcagctgtgtcaacgatcgtaaatctg
gcggaggaagcgagggaaggagtcaaagctccgagttatgcttttaaaagcatctgcaag
tctctttttgccggtggtgtcgctggtggagtgtcacgaactgctgttgcacctctggaa
aggatgaagatattacttcaggtccaaaatccgcataatataaagtacagtgggacagtc
caaggattgaagcatatttggagaaccgagggacttcgtggactgttcaaaggaaatggc
accaactgtgctcgtattgttcctaattcggctgttaaatttttcagctatgagcaagct
tcaaatggcatactgtacatgtatcgtcagcggaccggaaatgaaaatgcccaacttact
cctcttttacggcttggagctggtgcaaccgctgggataatagccatgtctgcaacgtac
ccgatggatatggttcgtggaaggctaactgtccagaccgcaaattctccttatcaatat
agaggaattgcccatgctttggcaactgtcctgcgagaggaaggtccacgggccttgtac
cgtggttggcttccatcagtgattggagttgttccatatgtgggcttgaacttttcggtg
tatgagtctctaaaggactggctagttaaagagaacccatacggtctagtagaaaacaat
gagctgacggttgtaacgaggctcacttgtggtgcaatagctggaacagttggtcaaaca
attgcttatccactggatgtgattcgtaggagaatgcaaatggtcgggtggaaagatgct
tccgctattgtaacaggcgaagggagaagcacagcttcacttgaatacactggtatggtc
gatgcatttagaaaaacagttcgtcatgaaggctttggagcattgtacaagggtttggtc
cccaattcagtgaaggttgtaccatcgattgcgattgcatttgtgacatatgagatggtg
aaagacgttttaggagtggagtttaggatatcagactga

DBGET integrated database retrieval system