KEGG   Arabidopsis thaliana (thale cress): AT4G02580
Entry
AT4G02580         CDS       T00041                                 

Definition
(RefSeq) NADH-ubiquinone oxidoreductase 24 kDa subunit
  KO
K03943  NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:7.1.1.2 1.6.99.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00190  Oxidative phosphorylation
ath01100  Metabolic pathways
Module
ath_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AT4G02580
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     AT4G02580
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     AT4G02580
SSDB
Motif
Pfam: 2Fe-2S_thioredx DUF1636
Other DBs
NCBI-GeneID: 828130
NCBI-ProteinID: NP_567244
MIPS: AT4G02580.1
TAIR: AT4G02580
Araport: AT4G02580
UniProt: O22769
Position
4
AA seq 255 aa
MLARLAAKRLLEIRQVFRQPTSQVTRSLSTALNYHLDSPDNKPDLPWEFSEANQSKVKEI
LSYYPSNYKQSAVIPLLDLAQQQNGGWLPVSAMNAVAKVIEVAPIRVYEVATFYSMFNRA
KVGKYHLLVCGTTPCMIRGSRDIESALLDHLGVKRGEVTKDGLFSVGEMECMGCCVNAPM
ITVADYSNGSEGYTYNYFEDVTPEKVVEIVEKLRKGEKPPHGTQNPKRIKCGPEGGNKTL
LGEPKPPQFRDLDAC
NT seq 768 nt   +upstreamnt  +downstreamnt
atgctggctaggctcgctgcgaagcgtcttctcgagatccgtcaagttttccgtcaacca
acctctcaggtgactcgtagcttatcgacggccttaaactaccatctggattctcctgat
aacaaacccgatcttccatgggagttttcagaggctaaccaatctaaggttaaggagatt
ctctcttactatccatccaattacaagcagtccgcagttattcctctcctagatcttgca
caacagcagaatggaggctggctccctgtttcagcaatgaatgcggttgctaaagttata
gaagttgcccctatccgtgtttatgaggttgcaacattttactcaatgttcaacagagca
aaggttggaaagtatcaccttctagtttgtggcacaacaccttgcatgatccgtggttca
cgagacatcgaatcagctttgctagaccatttgggagtgaaacgcggtgaggtcacaaag
gatggtttgttctctgttggagagatggagtgcatgggatgttgtgttaatgcacccatg
atcactgtggctgactattccaatggatcagaaggatatacatataactatttcgaagat
gttacacctgagaaagtcgtagaaattgttgaaaagctgagaaaaggagaaaagccaccg
catggaactcagaacccgaagaggatcaagtgtggaccagaaggagggaataagacactg
cttggtgagcctaagccaccacaattccgtgatcttgatgcatgctaa

DBGET integrated database retrieval system