KEGG   Arabidopsis thaliana (thale cress): AT4G02610Help
Entry
AT4G02610         CDS       T00041                                 

Definition
(RefSeq) Aldolase-type TIM barrel family protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01230  Biosynthesis of amino acids
Module
ath_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT4G02610
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT4G02610
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AT4G02610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB NMO NanE Ribul_P_3_epim TMP-TENI FMN_dh IGPS BtpA CbiX
Motif
Other DBs
NCBI-GeneID: 828226
NCBI-ProteinID: NP_192170
MIPS: AT4G02610.1
TAIR: AT4G02610
Araport: AT4G02610
UniProt: O22765 A0A178UX50
Position
4
AA seq 275 aa AA seqDB search
MDLLKTPSSTVGLSETFARLKSQGKVALIPYITAGDPDLSTTAKALKVLDSCGSDIIELG
VPYSDPLADGPAIQAAARRSLLKGTNFNSIISMLKEVIPQLSCPIALFTYYNPILRRGVE
NYMTVIKNAGVHGLLVPDVPLEETETLRNEARKHQIELVLLTTPTTPKERMNAIVEASEG
FIYLVSSVGVTGTRESVNEKVQSLLQQIKEATSKPVAVGFGISKPEHVKQVAEWGADGVI
VGSAMVKILGESESPEQGLKELEFFTKSLKSALVS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggatcttctcaagactccttcctccacggttggtctatcagaaacattcgctaggtta
aagtcacaaggcaaagtggctctgattccatatatcacagctggtgatcctgatctttct
acaacagcgaaagctcttaaagtgcttgattcgtgtggctccgacataatcgaactcggt
gttccatactctgatccattagctgatggtccagcaatccaggctgctgcgagacgttcg
ttacttaaaggaaccaactttaactccattatctctatgcttaaagaggttattcctcag
ttatcttgtccaattgcattgtttacatattacaatccaatcctgcgacgaggagtagag
aactacatgactgttataaagaatgctggagttcatgggcttctggttcctgatgttcca
ctcgaggagactgaaactctgcggaacgaagctcggaagcatcaaattgagctagtactg
ctcacaacacccacaactccaaaagaacgaatgaatgccattgttgaagcctctgaagga
tttatctatctcgtaagttcagtaggggttactggtacaagagagtctgttaacgaaaaa
gttcaatctcttctacaacaaatcaaagaggcaactagcaagccagtggcagttggattt
ggcatatcaaaacctgagcatgtgaaacaggtagctgaatggggagcagacggagtcatt
gttggtagcgcgatggttaagatcttgggcgagtctgaatcacctgagcaaggacttaag
gagctagaattcttcactaaatctttgaagtctgctcttgtctcttga

DBGET integrated database retrieval system