KEGG   Arabidopsis thaliana (thale cress): AT4G04370Help
Entry
AT4G04370         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 PPR_long ATP13 TPR_15
Motif
Other DBs
NCBI-GeneID: 825757
NCBI-ProteinID: NP_192346
MIPS: AT4G04370.1
TAIR: AT4G04370
Araport: AT4G04370
UniProt: Q9XE98
Position
4
AA seq 729 aa AA seqDB search
MIRTSSVLNSTKYFNSHINHLSSHGDHKQVLSTFSSMLANKLLPDTFTFPSLLKACASLQ
RLSFGLSIHQQVLVNGFSSDFYISSSLVNLYAKFGLLAHARKVFEEMRERDVVHWTAMIG
CYSRAGIVGEACSLVNEMRFQGIKPGPVTLLEMLSGVLEITQLQCLHDFAVIYGFDCDIA
VMNSMLNLYCKCDHVGDAKDLFDQMEQRDMVSWNTMISGYASVGNMSEILKLLYRMRGDG
LRPDQQTFGASLSVSGTMCDLEMGRMLHCQIVKTGFDVDMHLKTALITMYLKCGKEEASY
RVLETIPNKDVVCWTVMISGLMRLGRAEKALIVFSEMLQSGSDLSSEAIASVVASCAQLG
SFDLGASVHGYVLRHGYTLDTPALNSLITMYAKCGHLDKSLVIFERMNERDLVSWNAIIS
GYAQNVDLCKALLLFEEMKFKTVQQVDSFTVVSLLQACSSAGALPVGKLIHCIVIRSFIR
PCSLVDTALVDMYSKCGYLEAAQRCFDSISWKDVVSWGILIAGYGFHGKGDIALEIYSEF
LHSGMEPNHVIFLAVLSSCSHNGMVQQGLKIFSSMVRDFGVEPNHEHLACVVDLLCRAKR
IEDAFKFYKENFTRPSIDVLGIILDACRANGKTEVEDIICEDMIELKPGDAGHYVKLGHS
FAAMKRWDDVSESWNQMRSLGLKKLPGWSKIEMNGKTTTFFMNHTSHSDDTVSLLKLLSR
EMMQFGSNN
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaacttcgtctgtgttgaactccaccaagtacttcaactctcacattaaccat
ttatcatctcatggcgatcacaagcaagttctctcaacattctcttccatgctcgccaat
aaactcttacctgatacttttactttccctagtcttctcaaagcttgtgcttctcttcag
cgcctctcttttggtctctcgattcaccagcaggttctcgttaatgggttctcttcagat
ttctacatatcatcttcattggtcaatctttatgcgaaatttggactcttggctcatgct
cggaaagtgttcgaggaaatgcgtgagagagatgtggtgcactggactgcgatgattggg
tgttactcacgcgctggaattgttggagaagcttgttcgttggtgaacgagatgagattt
caggggatcaaaccgggtccggttacgttgttggaaatgttgagtggggttttagagatt
acgcagttacagtgtttacatgactttgctgtgatttatggttttgattgtgatatagct
gtgatgaactctatgttgaatttgtattgcaagtgtgatcatgttggagatgctaaggat
ttatttgatcagatggagcaacgagatatggtttcatggaacacaatgatttcagggtat
gcttctgttggtaatatgtctgaaatcttgaagcttttgtacagaatgagaggtgatggt
ttaagacctgatcagcagacatttggagcatcactttcagtgagtggaacaatgtgtgat
cttgaaatgggaagaatgttgcactgccaaattgtaaaaactggttttgatgtagatatg
catctcaagacggcattgataacaatgtacttgaagtgtggaaaggaggaagcttcatat
cgggtactcgaaacgattcccaataaggatgttgtttgctggacagtcatgatatcagga
cttatgcggttgggtagagcagaaaaggcactgattgttttctcggaaatgttacaatca
ggatcagacctgtcgagtgaagcaatagctagtgttgtagcatcttgtgctcaattgggt
tcctttgatcttggcgcttcagtccatggctatgtactgaggcatggatatacactagac
actcctgcgttgaactctttgatcacaatgtatgcaaagtgcggtcatttggataaaagt
ttagttatctttgaacggatgaatgaaagagacttagtttcgtggaatgcgattatctcc
ggatatgcccagaacgtagatctgtgtaaggccttgttattgtttgaagaaatgaagttc
aaaaccgtgcaacaagttgattcatttactgttgtctcacttttacaagcctgttcatct
gctggagctctccctgtagggaaactgatccactgtattgtaatcagaagctttatcagg
ccatgttccttggttgatacagctctagttgatatgtattcgaaatgtggctacttagaa
gctgcacagaggtgtttcgattcgatctcgtggaaagatgttgtttcatggggcatactc
attgcagggtatggttttcatggtaaaggggatattgctttggaaatttactcagagttt
cttcactctggaatggagccgaaccacgtgatatttcttgcagttctctcatcttgcagc
cataatggaatggttcaacaaggtttgaaaatattcagttcaatggtcagagattttggt
gttgaaccgaatcacgaacaccttgcttgtgtggttgatcttctatgtagagctaaaaga
atagaagacgcattcaagttctacaaagagaactttaccagaccttcgattgatgtcttg
ggtataatactcgatgcttgccgtgcaaatgggaaaacagaggtcgaagatataatttgt
gaggatatgatcgagttgaagccaggggacgctggacattacgtaaaactaggacattct
tttgctgcgatgaagagatgggacgatgtgagtgaatcatggaatcagatgaggtctctc
ggcttgaaaaagctcccgggatggagcaaaatcgagatgaacgggaaaaccacaacattt
ttcatgaatcatacatcacattcagatgatacagtgtctctattaaaacttcttagcagg
gaaatgatgcagtttggttcaaataattag

DBGET integrated database retrieval system