KEGG   Arabidopsis thaliana (thale cress): AT4G05120
Entry
AT4G05120         CDS       T00041                                 

Symbol
FUR1
Name
(RefSeq) Major facilitator superfamily protein
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT4G05120 (FUR1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   AT4G05120 (FUR1)
SSDB
Motif
Pfam: Nucleoside_tran DUF2678
Other DBs
NCBI-GeneID: 825857
NCBI-ProteinID: NP_001329797
TAIR: AT4G05120
UniProt: Q9M0Y3 A0A654FLQ1
Position
4:complement(2632524..2635143)
AA seq 418 aa
MADRYENQPPEKLQGKYQAMVVCCILGIGSLVSWNSMLTIADYYYKVFPDYHPSRVLTLV
YQPFALGTILILAYHESKINTRKRNLIGYILFTISTFLLIVLDLATKGRGGIGPYIGLCA
VVASFGLADATVQGGMIGDLSLMCPELVQSFMGGLAVSGALTSALRLITKAAFEKTNDGP
RKGAMMFLAISTCIELLCVFLYAYVFPKLPIVKYYRRKAASEGSKTVSADLAAAGIQNQS
DLTDDDSKNQRLSNKELLIQNIDYAVNLFLIYVCTLSIFPGFLYENTGQHGLGDWYALVL
VAMYNCWDLVGRYTPLVKWLKIENRKLITIAVLSRYLLIPAFYFTAKYGDQGWMIMLISV
LGLTNGHLTVCIMTIAPKGYKGPEQNALGNLLVIFLLGGIFAGVALDWLWLIGKKNAF
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcggatagatatgagaaccaacctcctgagaagcttcaggggaagtatcaagcaatg
gttgtttgctgtattcttggaattggatctctcgtttcttggaacagtatgctcactata
gcagattactactacaaagtttttccggattatcatccttcaagggtactcacacttgta
taccaaccgtttgcgcttggaacaatcttgattctcgcataccacgaatcgaaaatcaat
actcgaaaacgtaacctcattggttacattctattcacaatatccacattcttgctcata
gttttggatttggcaacaaaaggacgtggtggaatcggtccttatatcggtttatgcgct
gttgttgcttcttttggcctcgcggatgctacagttcaaggaggaatgatcggtgattta
tcattgatgtgccctgaactagttcagtcattcatgggaggtttggctgtatctggtgcg
ctaacatcagcacttcggctaataactaaagcagcctttgagaaaacaaacgacggtcca
cgaaaaggagcaatgatgttcttagctatctccacatgcatagagttactctgtgtgttt
ctatatgcttatgtgttcccgaaactcccgattgttaagtattaccgaagaaaagccgct
tctgaaggatccaaaactgtttctgctgatcttgctgctgctggtatccaaaatcaatca
gacttgactgatgatgattccaagaatcaaaggctaagcaacaaagagctattgattcaa
aacatagactatgcagtgaatttattcctcatctacgtttgcacgttatccattttcccg
gggtttttatatgaaaacacaggacaacacgggctaggcgattggtacgcacttgtctta
gtagcgatgtacaattgttgggacttggtcgggaggtacacaccactggtgaaatggctc
aagattgagaatagaaagttgatcacaatcgcggtattgtcacgttatcttctcattccg
gcgttctacttcactgcgaaatatggtgatcagggatggatgattatgctcatttctgtt
ttggggttgactaatggacatctcactgtttgcattatgactatagctcctaaaggatac
aagggtccggagcagaatgcgttagggaacttactggtgatatttctgttaggagggata
tttgcaggagttgctttggattggttatggcttattggtaagaagaatgccttttga

DBGET integrated database retrieval system