KEGG   Arabidopsis thaliana (thale cress): AT4G05320Help
Entry
AT4G05320         CDS       T00041                                 

Gene name
UBQ10
Definition
(RefSeq) polyubiquitin 10
  KO
K08770  ubiquitin C
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Ubiquitin system [BR:ath04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   AT4G05320 (UBQ10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2407 Methyltrans_RNA
Motif
Other DBs
NCBI-GeneID: 825880
NCBI-ProteinID: NP_001328998
MIPS: AT4G05320.1
TAIR: AT4G05320
Araport: AT4G05320
UniProt: Q8H159 Q3E7T8 A0A178V886 J7FN14
Position
4
AA seq 305 aa AA seqDB search
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgttaagactctcaccggaaagacaatcaccctcgaggtggaaagctcc
gacaccatcgacaacgttaaggccaagatccaggataaggagggcattcctccggatcag
cagaggcttattttcgccggcaagcagctagaggatggccgtacgttggctgattacaat
atccagaaggaatccaccctccacttggtcctcaggctccgtggtggtatgcagattttc
gttaagacgttgactgggaaaactatcactttggaggtggagagttctgacaccattgat
aacgtgaaagccaagatccaagacaaagagggtattcctccggaccagcagagattgatc
ttcgccggaaaacaacttgaagatggcagaactttggccgactacaacattcagaaggag
tccacactccacttggtcttgcgtctgcgtggaggtatgcagatcttcgtgaagactctc
accggaaagaccatcactttggaggtggagagttctgacaccattgataacgtgaaagcc
aagatccaggacaaagagggtatcccaccggaccagcagagattgatcttcgccggaaag
caacttgaagatggaagaactttggctgactacaacattcagaaggagtccacacttcac
ttggtcttgcgtctgcgtggaggtatgcagatcttcgtcaagactttgaccggaaagacc
atcacccttgaagtggaaagctccgacaccattgacaacgtcaaggccaagatccaggac
aaggaaggtattcctccggaccagcagcgtctcatcttcgctggaaagcagcttgaggat
ggacgtactttggccgactacaacatccagaaggagtctactcttcacttggtcctgcgt
cttcgtggtggtttctaa

DBGET integrated database retrieval system