KEGG   Arabidopsis thaliana (thale cress): AT4G06634
Entry
AT4G06634         CDS       T00041                                 

Gene name
YY1
Definition
(RefSeq) zinc finger (C2H2 type) family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_8
Other DBs
NCBI-GeneID: 826093
NCBI-ProteinID: NP_849323
MIPS: AT4G06634.1
TAIR: AT4G06634
UniProt: Q2V3L3 A0A178V3M9
Position
4
AA seq 387 aa
MDHQNYQYQNPFERRPILKSKAPAVKWIKEWVPQDIVATGGKCHLHKWVTEDTFSRLKEK
EKEPDVPEPEPEPTTEILFLCSYDGCGKTFFDVSALRKHSHIHGERQYVCDQEGCGKKFL
DSSKLKRHYLIHTGERNYICTYEGCGKAFSLDFNLRSHMKTHSQENYHICPYSGCVKRYA
HEYKLKNHVAAYHEKNGGGETPKYTPPAEKVLRTVKTPATVCGPSSDRPYACPYEGCEKA
YIHEYKLKLHLKREHPGHLQEENADTPTLNKHNGNDRNEIDDGSDQDVYRKHASNGKGQT
HKQQSRAKPNMRTPPAKVGKKGSTSSPAKARIAKKPWQAKETFEEVEREEEEDSEETEED
RDNVEDGWRFGENNEDDDDDEETEYED
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggatcatcaaaattatcaataccaaaatcctttcgagagacgacccatccttaaatcc
aaagctcctgctgtgaagtggatcaaagaatgggtaccacaagatattgttgctacaggt
ggaaagtgtcatctacacaaatgggtcacagaggatacttttagcagacttaaagaaaaa
gagaaagagcctgatgttcctgagcctgaacctgaaccaactacagagattttgtttctc
tgtagttatgatggttgcgggaagactttctttgatgttagtgcattgaggaaacattct
catatccatggagaaagacaatatgtttgtgatcaggaaggatgtggaaagaaatttctg
gatagttcaaagttgaagagacattatcttattcatactggagagagaaattatatatgt
acttatgaaggatgtggaaaggcattctcgttggattttaaccttaggtctcacatgaag
actcattcacaagagaattatcatatatgtccttacagtgggtgtgtgaagagatatgct
catgaatacaagctaaagaaccacgttgctgcctaccatgaaaagaatggtggtggagag
actcccaaatatacaccaccagcagagaaagtattaaggactgtcaaaacacctgcaaca
gtttgtggcccgtcttcggatcggccatacgcatgcccttacgaagggtgtgagaaagct
tacatacatgagtacaagcttaagctccacttgaagagagaacatccagggcatttacaa
gaagagaacgcggatacccccacactgaacaagcacaatggcaatgacaggaatgagata
gatgacgggagtgaccaagatgtttacaggaaacacgctagtaatgggaaaggccagaca
cataaacaacagagcagagctaagccaaacatgaggacaccaccagccaaagttggaaag
aaaggttctacctcttcgcctgccaaagcaaggattgcaaaaaaaccatggcaagcaaaa
gaaacttttgaagaagtagaaagagaagaagaagaagatagcgaggagacagaggaagat
agagataatgtggaggatggctggaggtttggcgaaaacaacgaggatgatgacgacgat
gaagagaccgagtatgaagattag

DBGET integrated database retrieval system