KEGG   Arabidopsis thaliana (thale cress): AT4G08790Help
Entry
AT4G08790         CDS       T00041                                 

Definition
(RefSeq) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT4G08790
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     AT4G08790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 826449
NCBI-ProteinID: NP_567340
MIPS: AT4G08790.1
TAIR: AT4G08790
Araport: AT4G08790
UniProt: Q94JV5
Position
4
AA seq 307 aa AA seqDB search
MNAYSVSLDFTKPSLFTRITLSSQIPLTMATTVNKTVRVAAAQMTSVNDLMTNFATCSRL
VQEAALAGAKLICFPENFSFVGDKEGESVKIAEPLDGPVMERYCSLARDSNIWLSLGGFQ
ERFDDTHLCNTHVVIDDAGMIRDTYQKMHLFDVDVPGGSSYKESSFTVPGTKIVSVDSPV
GRLGLTVCYDLRFPKIYQQLRFEQKAQVLLVPSAFTKVTGEAHWEILLRARAIETQCYVI
AAAQAGKHNEKRESYGDTLIIDPWGTVVGRLPDRVSTGIVVADIDFSLIDSVRTKMPIDK
QRVSIDL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttactctgtttctctcgacttcactaaaccttctctattcacacgcatcact
ctctcttctcagattcctctaaccatggccaccactgtaaacaaaacagttcgtgtcgca
gctgctcaaatgacatcggtcaatgatctaatgaccaacttcgccacttgctctcgtctc
gttcaagaagcagcattggctggtgcaaagctgatttgcttccctgagaacttctctttt
gtgggagataaggaaggagagagtgtgaaaattgctgaaccattagatggcccagtgatg
gaacggtattgctctctcgccagggattcaaatatatggttgtctcttggaggttttcaa
gagagatttgatgatactcatttgtgtaatacacatgttgtgatcgatgatgctggaatg
atccgagacacttatcagaaaatgcatttgtttgatgttgatgttcctggtggaagctcg
tacaaagaaagcagctttacagttccagggacaaagattgtttccgtagacagccctgtc
gggcgcttaggccttactgtatgctacgatttgaggttccctaagatatatcagcaactg
agatttgaacagaaagctcaggttttactagtaccatcagctttcaccaaggtcactggg
gaggcacactgggagattcttcttcgagcccgagcaattgaaactcaatgttatgtcata
gctgctgctcaagcaggaaagcataatgagaaaagagaaagttatggtgacacactgatc
attgatccgtggggaactgtagttggaaggttacctgatcgtgtttcgaccggcattgtc
gtggcagatattgatttttcattgattgactcagtgagaacaaaaatgccaatagataag
caacgagtctcaatagatctctga

DBGET integrated database retrieval system