KEGG   Arabidopsis thaliana (thale cress): AT4G08900Help
Entry
AT4G08900         CDS       T00041                                 

Gene name
ARGAH1
Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00220  Arginine biosynthesis
ath00330  Arginine and proline metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AT4G08900 (ARGAH1)
   00330 Arginine and proline metabolism
    AT4G08900 (ARGAH1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AT4G08900 (ARGAH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 826468
NCBI-ProteinID: NP_192629
MIPS: AT4G08900.1
TAIR: AT4G08900
Araport: AT4G08900
UniProt: P46637 A0A178UW48
Position
4
AA seq 342 aa AA seqDB search
MSRIIGRKGINYIHRLNSASFTSVSASSIEKGQNRVIDASLTLIRERAKLKGELVRLLGG
AKASTSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEEGKELKDPRVLTDVGDV
PVQEIRDCGVDDDRLMNVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVD
ILHLDAHPDIYDCFEGNKYSHASSFARIMEGGYARRLLQVGIRSINQEGREQGKRFGVEQ
YEMRTFSKDRPMLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILH
NLQADVVGADVVEFNPQRDTVDGMTAMVAAKLVRELAAKISK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggattattggtagaaaagggattaactatatccatagactaaattctgcgtcg
ttcacgagcgtatctgcttcttcaatcgagaaagggcaaaatcgcgtgattgatgcttcg
ttaactcttattcgtgaaagggcaaaactcaaaggagagttagtgcgtcttttaggtgga
gctaaagcttcaacatctcttcttggtgtaccacttggtcacaactcttcttttcttcaa
ggtcctgcttttgctcctcctcgtattcgagaagctatttggtgtggtagcacaaactct
gccactgaagaagggaaggagttgaaggatccacgggttctaactgatgttggggatgtt
ccggtacaagagattagagattgtggggttgatgatgatagactgatgaatgtcataagt
gaatctgtgaagttggtgatggaagaggaaccattgcgtccgttggtcttaggtggagac
cattccatatcttatcctgttgtgagagcggtttctgagaagcttggagggcctgtggac
attcttcatcttgatgcacatccggatatatatgactgttttgaaggaaataagtactct
catgcatcttcttttgctcgtatcatggaaggtggctatgcgcgtaggcttttacaggtt
gggatcagatcgataaaccaggaaggacgggaacaaggcaagaggtttggagtagaacag
tatgagatgcgaaccttctcgaaagatcgcccaatgttggaaaatctgaaattaggggaa
ggagtgaagggggtatacatctcgatagacgttgactgtctcgatccggcatttgcacct
ggagtgtcgcatatcgaaccaggaggtctctctttccgtgacgtccttaacatcttacac
aaccttcaggcagatgttgtcggggctgacgttgtcgagttcaacccgcagcgtgatact
gttgacggcatgacagcaatggttgcagctaagcttgttagagaattagctgcgaaaatc
tcgaaatga

DBGET integrated database retrieval system