KEGG   Arabidopsis thaliana (thale cress): AT4G09650Help
Entry
AT4G09650         CDS       T00041                                 

Gene name
ATPD
Definition
(RefSeq) F-type H+-transporting ATPase subunit delta
  KO
K02113  F-type H+-transporting ATPase subunit delta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00190  Oxidative phosphorylation
ath00195  Photosynthesis
ath01100  Metabolic pathways
Module
ath_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    AT4G09650 (ATPD)
   00195 Photosynthesis
    AT4G09650 (ATPD)
Photosynthesis proteins [BR:ath00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   AT4G09650 (ATPD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OSCP FAA_hydrolase_N Rap_GAP SMK-1 RAC_head
Motif
Other DBs
NCBI-GeneID: 826551
NCBI-ProteinID: NP_192703
MIPS: AT4G09650.1
TAIR: AT4G09650
Araport: AT4G09650
UniProt: Q9SSS9 A0A178V1L3
Position
4
AA seq 234 aa AA seqDB search
MASLQQTLFSLQSKLPPSSFQIARSLPLRKTFPIRINNGGNAAGARMSATAASSYAMALA
DVAKRNDTMELTVTDIEKLEQVFSDPQVLNFFANPTITVEKKRQVIDDIVKSSSLQSHTS
NFLNVLVDANRINIVTEIVKEFELVYNKLTDTQLAEVRSVVKLEAPQLAQIAKQVQKLTG
AKNVRVKTVIDASLVAGFTIRYGESGSKLIDMSVKKQLEDIASQLELGEIQLAT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcttcaacaaactctattctctcttcaatccaaactcccaccatcctccttc
caaatcgccagatctctcccactccgaaaaaccttcccaatccgaatcaacaacggtgga
aacgccgccggagcaagaatgtcagccaccgcagcatcaagctacgcgatggcattagca
gacgtcgcgaaaagaaacgacacaatggaattaacagtcacagacatcgagaagctcgaa
caagtcttctcagatccacaagtactaaacttcttcgcgaatccaacaatcaccgtcgag
aagaaacgtcaagtcatcgacgacatagtgaaatcgtcgtctcttcaatctcacacatct
aacttcctcaacgtcctcgtcgacgcgaatcggatcaatatcgtgacggagatcgttaag
gagtttgagttggtttacaataagctaacggatacacaattggcggaggttaggtcggtg
gtgaaattggaagcgccgcaattagctcagattgcgaaacaggttcagaagttaaccgga
gctaagaatgttcgggttaagacggttattgatgcgagtcttgtggctggttttacgatt
cggtatggtgaatccggttcgaagcttattgatatgagtgtgaagaaacagcttgaagat
attgcttctcagcttgaacttggtgagattcaattagctacttga

DBGET integrated database retrieval system