KEGG   Arabidopsis thaliana (thale cress): AT4G12740Help
Entry
AT4G12740         CDS       T00041                                 

Definition
(RefSeq) HhH-GPD base excision DNA repair family protein
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AT4G12740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G12740
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     AT4G12740
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     AT4G12740
 Prokaryotic Type
     AT4G12740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD NUDIX_4 HHH Cid2 DUF2457 Nop53 BUD22 EndIII_4Fe-2S Whib Merozoite_SPAM DUF3678 dsRBD2 NOA36 RNA_pol_3_Rpc31 Borrelia_P83 Adaptin_binding PPP4R2 Paf1 Raftlin
Motif
Other DBs
NCBI-GeneID: 826886
NCBI-ProteinID: NP_193010
MIPS: AT4G12740.1
TAIR: AT4G12740
Araport: AT4G12740
UniProt: F4JRF4
Position
4
AA seq 630 aa AA seqDB search
MACLLRVALNPTFERSTVASQRQNPKTILSFHCKVSSFKTKTMSQSFAPREKLMRKCREK
KEAEREAEREAEREAEEEEKAEEAEAEADKEEAEEESEEEEEEEEEEAEAEEEALGGDIE
DLFSENETQKIRMGLLDWYDVNKRDLPWRNRRSESEKERRAYEVWVSEIMLQQTRVQTVM
KYYKRWMQKWPTIYDLGQASLENLIVSRSRELSFLRGNEKKEVNEMWAGLGYYRRARFLL
EGAKMVVAGTEGFPNQASSLMKVKGIGQYTAGAIASIAFNEAVPVVDGNVIRVLARLKAI
SANPKDRLTARNFWKLAAQLVDPSRPGDFNQSLMELGATLCTVSKPSCSSCPVSSQCRAF
SLSEENRTISVTDYPTKVIKAKPRHDFCCVCVLEIHNLERNQSGGRFVLVKRPEQGLLAG
LWEFPSVILNEEADSATRRNAINVYLKEAFRFHVELKKACTIVSREELGEFVHIFTHIRR
KVYVELLVVQLTGGTEDLFKGQAKDTLTWKCVSSDVLSTLGLTSAVRKVPPFRLQHIKRL
SLDVMVEKEQILECRCIQWLKHTSKAYLFLMSHQIEQPYRGNENSHDLLLTLFFMLLSFY
SSCLALGIKFGDLGLKLNSLVSTEKSDGDV
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtcttctccgcgtggctctaaaccctacattcgaaagatcaacggtcgcttca
cagagacaaaatccaaagaccattctaagttttcattgcaaagtttcgagctttaagacc
aaaacgatgtcccaatcttttgctcctcgcgagaaactcatgagaaagtgtcgagagaaa
aaagaagcagaacgagaagcagaacgagaagcagaacgagaagcagaagaagaagaaaaa
gcagaagaagcagaagcagaagcagacaaagaagaagcagaagaagaatcagaagaagaa
gaagaagaagaagaagaagaagcagaagcagaagaagaagcgcttggaggagatatagag
gatctctttagtgaaaatgaaactcagaaaatcagaatgggtttgcttgattggtacgat
gtgaataagagagatcttccatggaggaacagaagaagtgaaagtgaaaaggagagaaga
gcttatgaggtttgggtatcggagattatgcttcagcaaactagggttcagactgtaatg
aagtattataaacgttggatgcagaaatggccaaccatttatgaccttggtcaagcttct
cttgagaatcttatcgttagtagatcaagagagctttcttttcttagggggaatgagaaa
aaagaggtaaacgaaatgtgggcaggtttgggatactatcggcgggcacgttttctttta
gagggtgcaaagatggttgttgcagggacggagggtttccctaatcaagcgtctagcttg
atgaaagttaaaggaataggacagtacacagccggagcaattgcctcaattgctttcaat
gaggcagtacctgttgttgatggaaatgtgataagagtgcttgctagattaaaagccatc
tcagctaatccaaaagaccgacttacggccaggaatttctggaaactagctgctcagcta
gtggatccttcacgccctggagatttcaaccaatctctgatggagcttggtgctacacta
tgcactgtatcaaagccaagttgctcttcttgtcctgtttccagccaatgtcgtgcattt
tcactttccgaggaaaacagaacgatttccgtgacagattatcctacaaaagtaatcaag
gccaagccaaggcacgacttttgttgcgtttgtgttttggagatacataatctggagagg
aaccaatcaggaggtagatttgttcttgtaaaaagacccgaacaaggtctgcttgctggt
ctttgggagttcccatctgttatattaaatgaggaagctgattcggcaacaaggaggaac
gcaataaacgtctaccttaaggaagcatttcgttttcatgtagaactcaagaaagcatgc
actatagtttcaagagaagaactcggagaattcgtccacatattcactcacattcgtcga
aaagtttatgtggagctattagttgtacaacttacaggcggaaccgaagatctgttcaaa
ggtcaggcaaaggacactctaacatggaagtgtgtgagcagtgatgttctttctaccttg
ggactgacatcagctgttagaaaggtacctccttttcgtcttcaacatattaaaagacta
tccttggatgtgatggttgagaaggaacaaattttggagtgcaggtgtattcaatggttg
aagcacacaagcaaggcttatctgtttctcatgtctcatcaaatagaacagccatatcga
ggaaacgaaaattctcatgatctccttctcacacttttcttcatgttgcttagcttctat
agttcttgtctagcattgggaatcaaatttggtgatcttggtttgaaattgaacagctta
gtttctactgagaaaagtgacggtgatgtgtga

DBGET integrated database retrieval system