KEGG   Arabidopsis thaliana (thale cress): AT4G13640Help
Entry
AT4G13640         CDS       T00041                                 

Gene name
UNE16
Definition
(RefSeq) Homeodomain-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_CC_LHEQLE Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 826998
NCBI-ProteinID: NP_567408
MIPS: AT4G13640.1
TAIR: AT4G13640
Araport: AT4G13640
UniProt: Q8LAJ7 A0A178UXZ1
Position
4
AA seq 292 aa AA seqDB search
MYSAIRSSLPLDGSLGDYSDGTNLPIDACLVLTTDPKPRLRWTSELHERFVDAVTQLGGP
DKATPKTIMRTMGVKGLTLYHLKSHLQKFRLGRQSCKESIDNSKDVSCVAESQDTGSSST
SSLRLAAQEQNESYQVTEALRAQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACK
AIEEQAVAFAGLEAAREELSELAIKASITNGCQGTTSTFDTTKMMIPSLSELAVAIEHKN
NCSAESSLTSSTVGSPVSAALMKKRQRGVFGNGDSVVVGHDAGWVMPSSSIG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtactcggcgattcggtcttcgcttcctctagatggcagcttgggagactactctgac
ggaaccaatcttcccatcgacgcttgtctggtcctaaccactgaccccaagcctcgcctt
cgttggacctctgagctccatgaaagattcgttgacgccgtcactcagctcggcggaccc
gacaaagcaacgcctaaaactataatgagaacaatgggagtgaagggtctcactctttac
catctcaaatctcatcttcagaaattccgcttggggaggcaatcttgtaaagaatcaatt
gacaactctaaggatgtttcttgtgttgcggagagtcaggacactggttcatcttcaaca
tcatccttaagattggctgctcaagaacagaacgagagttaccaggtcactgaagctttg
cgtgcccagatggaagtccaaagaagactacacgagcaactagaggtgcaaaggcgactc
cagttaaggatcgaggcacaagggaagtacctgcaatcaattctagagaaagcttgcaag
gctatagaggagcaagctgttgcatttgctgggttagaggcagctagagaagagctttca
gagctagccataaaggcctccatcaccaatgggtgccaaggaacaacaagcaccttcgac
acaaccaaaatgatgattccatccttatccgagcttgcagtagcaatagagcacaagaac
aactgttcagcagagagctctctgacttccagcactgtaggaagtccggtatcagctgcg
ttgatgaagaagagacaacgaggagtgtttggaaatggagatagtgtggttgttggtcat
gatgctggatgggttatgcctagtagtagcattggatga

DBGET integrated database retrieval system