KEGG   Arabidopsis thaliana (thale cress): AT4G13650Help
Entry
AT4G13650         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR DYW_deaminase PPR_1 PPR_3 PPR_long
Motif
Other DBs
NCBI-GeneID: 826999
NCBI-ProteinID: NP_193101
MIPS: AT4G13650.1
TAIR: AT4G13650
Araport: AT4G13650
UniProt: Q9SVP7
Position
4
AA seq 1064 aa AA seqDB search
MNKYIWLVRLWHSKEEPMFLRSVSSSFIFIHGVPRKLKTRTVFPTLCGTRRASFAAISVY
ISEDESFQEKRIDSVENRGIRPNHQTLKWLLEGCLKTNGSLDEGRKLHSQILKLGLDSNG
CLSEKLFDFYLFKGDLYGAFKVFDEMPERTIFTWNKMIKELASRNLIGEVFGLFVRMVSE
NVTPNEGTFSGVLEACRGGSVAFDVVEQIHARILYQGLRDSTVVCNPLIDLYSRNGFVDL
ARRVFDGLRLKDHSSWVAMISGLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKK
IESLEIGEQLHGLVLKLGFSSDTYVCNALVSLYFHLGNLISAEHIFSNMSQRDAVTYNTL
INGLSQCGYGEKAMELFKRMHLDGLEPDSNTLASLVVACSADGTLFRGQQLHAYTTKLGF
ASNNKIEGALLNLYAKCADIETALDYFLETEVENVVLWNVMLVAYGLLDDLRNSFRIFRQ
MQIEEIVPNQYTYPSILKTCIRLGDLELGEQIHSQIIKTNFQLNAYVCSVLIDMYAKLGK
LDTAWDILIRFAGKDVVSWTTMIAGYTQYNFDDKALTTFRQMLDRGIRSDEVGLTNAVSA
CAGLQALKEGQQIHAQACVSGFSSDLPFQNALVTLYSRCGKIEESYLAFEQTEAGDNIAW
NALVSGFQQSGNNEEALRVFVRMNREGIDNNNFTFGSAVKAASETANMKQGKQVHAVITK
TGYDSETEVCNALISMYAKCGSISDAEKQFLEVSTKNEVSWNAIINAYSKHGFGSEALDS
FDQMIHSNVRPNHVTLVGVLSACSHIGLVDKGIAYFESMNSEYGLSPKPEHYVCVVDMLT
RAGLLSRAKEFIQEMPIKPDALVWRTLLSACVVHKNMEIGEFAAHHLLELEPEDSATYVL
LSNLYAVSKKWDARDLTRQKMKEKGVKKEPGQSWIEVKNSIHSFYVGDQNHPLADEIHEY
FQDLTKRASEIGYVQDCFSLLNELQHEQKDPIIFIHSEKLAISFGLLSLPATVPINVMKN
LRVCNDCHAWIKFVSKVSNREIIVRDAYRFHHFEGGACSCKDYW
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatatatttggttggttcgtctttggcattctaaggaggaacccatgtttctt
cgctcagtgtcgtcctcatttatcttcattcatggtgttcctcgtaagctcaagaccaga
actgtctttcctactctttgtgggaccaggagagctagttttgctgctatatctgtttat
atctctgaggatgaatcatttcaagaaaagagaattgattccgtggagaatcgtggaatt
cgacctaatcatcaaactttgaaatggcttcttgaaggatgtttgaagacaaatgggtct
ttagatgaaggaagaaagctacattcccagattttgaagttgggtttggatagcaatggt
tgcctctctgaaaagctttttgatttttatctttttaaaggagatttatatggtgctttc
aaggtgtttgacgaaatgcctgagagaacgatttttacttggaataagatgataaaggag
ttagcttctaggaatttgattggagaagtgtttggtctttttgtgagaatggttagtgag
aatgttactccgaatgaaggaactttcagtggtgttttggaagcatgtcgtggtggtagt
gttgcttttgatgtagttgagcagattcatgcaaggattttatatcagggcttgagggat
agtacggttgtgtgtaatcctttgattgacttgtactctaggaatgggtttgtggattta
gctagaagggtttttgatgggttacgtctgaaggatcatagttcttgggttgcaatgata
tccgggctttcgaaaaatgaatgtgaagcagaagccattagattgttctgcgatatgtat
gttttaggtatcatgccaacgccttatgcgttttcaagtgttttaagtgcgtgtaagaag
atagaatctcttgagattggtgagcagcttcatgggctcgtattgaagttagggttttcc
tccgacacttatgtttgcaatgcacttgtgtctttgtactttcatttgggaaatttgata
tcagcagaacacatcttcagtaacatgtcacagagagatgcagttacttataacactctt
atcaacgggctttctcagtgtggttatggtgagaaagctatggaattgttcaaaagaatg
caccttgatggacttgaaccagacagtaatactcttgcgagccttgtggttgcatgttca
gctgatggaactctgtttaggggacaacagctacatgcatacacaactaaacttggtttt
gcttcaaacaacaagattgaaggtgcgctccttaatctgtatgcaaaatgcgctgatatt
gaaaccgcccttgattattttcttgagactgaggttgaaaatgtagttctctggaatgtg
atgctagtagcttatgggttattagacgatttaagaaattcttttaggattttcagacag
atgcagatagaggaaattgttccaaatcaatatacctacccgagtattttgaaaacttgc
atacgacttggggatctggagcttggagaacaaatccatagtcaaataataaaaactaac
tttcagctcaatgcctatgtttgtagtgtgctcatcgatatgtatgcaaaattaggaaag
ttggatactgcctgggatatacttataaggtttgctggaaaagatgttgtgtcttggaca
acaatgattgcaggttacacgcaatacaatttcgacgacaaagctttaacaactttcagg
cagatgttggatcgagggattcggtctgatgaagttggattgacaaatgcagttagtgca
tgtgctggtcttcaagccttaaaggaaggacagcaaattcatgctcaagcttgtgtatct
ggtttctcatctgacctgccatttcaaaatgcactggttacactttattctagatgcgga
aaaatagaggaatcgtatttagcgtttgaacaaactgaagctggagataatatagcatgg
aatgctctggtatccggatttcagcagagtggaaacaatgaagaagcacttcgtgtcttc
gttcgaatgaacagagaaggaattgacaataataatttcacgtttgggtctgctgtgaaa
gctgcttctgagacagctaacatgaaacaagggaagcaggttcatgctgtgatcaccaaa
accggatacgattcagaaaccgaagtttgcaatgctttaatctctatgtatgccaagtgt
gggagcatttctgatgcagagaagcagttccttgaagtctccacgaaaaatgaagtttcg
tggaatgcgataattaatgcttattctaaacatgggtttggttctgaagcactagattct
tttgaccagatgatacattctaatgtaaggcctaatcatgtgacgcttgtgggagttcta
tcagcatgtagccacataggactagtggacaaggggattgcatactttgaatccatgaat
tcagaatatggattatctcctaaaccggaacactatgtgtgtgtagtggatatgctaact
cgagctggtcttttgagccgtgcgaaagagttcattcaggaaatgcctattaagccagat
gccttggtctggagaacacttttgagtgcttgtgtagtgcacaagaacatggaaatagga
gaatttgcagcgcatcatctcctagagttagaacctgaagactcagcaacatatgttctt
ctgtcaaatctgtatgcggtgtccaagaaatgggatgctagggatcttacaagacaaaag
atgaaagaaaagggtgtgaagaaagaaccgggacaaagttggattgaagttaaaaactca
attcactctttctatgttggtgaccagaatcacccgttagcagatgagatacatgaatac
ttccaagatcttaccaaacgagcatctgaaatcgggtatgtgcaagactgtttcagccta
ttgaatgaactgcagcacgagcaaaaagatccaataattttcatccacagcgagaaatta
gcaatttcatttggactccttagcttgcctgcaacagtgcctataaatgtaatgaagaac
ctacgtgtttgcaacgattgccatgcttggataaagtttgtatctaaggtatcaaatcga
gaaatcatagtgagggatgcatataggtttcatcattttgaaggaggtgcttgctcttgt
aaagattactggtaa

DBGET integrated database retrieval system