KEGG   Arabidopsis thaliana (thale cress): AT4G14050Help
Entry
AT4G14050         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 DYW_deaminase PPR_1 PPR_3 PPR_long
Motif
Other DBs
NCBI-GeneID: 827041
NCBI-ProteinID: NP_193141
MIPS: AT4G14050.1
TAIR: AT4G14050
Araport: AT4G14050
UniProt: O23266
Position
4
AA seq 612 aa AA seqDB search
MLIPHYLHQLQLCARNRTLTTAKALHAHIVKLGIVQCCPLANTLVNVYGKCGAASHALQV
FDEMPHRDHIAWASVLTALNQANLSGKTLSVFSSVGSSSGLRPDDFVFSALVKACANLGS
IDHGRQVHCHFIVSEYANDEVVKSSLVDMYAKCGLLNSAKAVFDSIRVKNTISWTAMVSG
YAKSGRKEEALELFRILPVKNLYSWTALISGFVQSGKGLEAFSVFTEMRRERVDILDPLV
LSSIVGACANLAASIAGRQVHGLVIALGFDSCVFISNALIDMYAKCSDVIAAKDIFSRMR
HRDVVSWTSLIVGMAQHGQAEKALALYDDMVSHGVKPNEVTFVGLIYACSHVGFVEKGRE
LFQSMTKDYGIRPSLQHYTCLLDLLGRSGLLDEAENLIHTMPFPPDEPTWAALLSACKRQ
GRGQMGIRIADHLVSSFKLKDPSTYILLSNIYASASLWGKVSEARRKLGEMEVRKDPGHS
SVEVRKETEVFYAGETSHPLKEDIFRLLKKLEEEMRIRNGYVPDTSWILHDMDEQEKEKL
LFWHSERSAVAYGLLKAVPGTPIRIVKNLRVCGDCHVVLKHISEITEREIIVRDATRYHH
FKGGKCSCNDFW
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgcttatccctcactatcttcatcagctccagctctgcgccaggaatcgaaccctaacc
actgctaaagccctccatgcccacatcgtcaagctcgggatcgttcaatgttgccctttg
gccaacacacttgtcaatgtctatgggaaatgcggtgctgcttctcatgctctccaggtg
ttcgacgaaatgcctcatagagatcacatcgcctgggcctcggttctcacagctcttaat
caagccaatctctctggtaagacactatcagtattttcttcagtgggttcgagctctggg
ttgcgtcctgatgattttgtgttctcggctcttgttaaggcttgtgctaacttaggatct
attgatcacgggaggcaagttcattgccattttatagtctctgagtatgctaatgatgaa
gttgttaagtcttcactggttgatatgtatgctaaatgtggattgcttaatagtgctaaa
gcagttttcgattctataagagtgaaaaacaccatttcatggactgcaatggtatctgga
tatgctaaaagcggaagaaaggaagaagctttggagctttttaggatattaccagtcaag
aatttgtattcttggactgcgttgatctctggttttgtacagagtgggaaagggcttgaa
gctttttctgttttcactgaaatgaggagagaaagagttgacattttggatcctttagtt
ctttcgagcatcgttggcgcttgtgctaatttggcagcttctatagcggggaggcaggtt
catgggttggttatagctctaggatttgattcttgtgtgtttattagtaacgcccttatc
gatatgtacgctaaatgcagcgatgttatagctgcaaaggatattttcagtaggatgcgt
cacagagatgtagtttcatggacatcgcttatagttggaatggctcagcacgggcaggct
gagaaggcattagcgttgtatgatgacatggtttctcacggtgtaaagcccaatgaggtc
acatttgttgggttgatatatgcgtgtagccatgtcggttttgttgagaaaggccgtgag
cttttccaatcaatgactaaggactatggaattcgcccatctttgcagcattatacatgc
ttattggatcttctcggtcgctctggactccttgatgaggctgagaacttaattcataca
atgccgtttcctccagatgaaccaacatgggctgctttacttagcgcttgcaagcgccag
ggacgaggtcagatgggtataagaatcgctgatcatctcgtaagcagctttaaactgaaa
gatccatcgacttatatacttttatcaaacatctatgcaagtgcttctttgtggggaaaa
gtatcagaagcaagaaggaaactaggagaaatggaagttagaaaggatccagggcacagt
agcgtcgaggtacggaaagaaaccgaagtgttttacgcaggagaaacatctcatcctcta
aaagaagacatttttcgattgcttaagaagctagaggaagaaatgaggataagaaatggt
tatgttcctgatactagttggatcctacacgacatggatgagcaagagaaagaaaagctt
ttgttttggcatagcgaacgatccgctgttgcatacggattgcttaaagctgttccggga
actcctatacggattgtgaaaaatctaagggtttgtggagattgtcatgttgttctgaaa
catataagtgagattacagaaagagagattatagttagagatgcgactagatatcatcat
tttaagggaggaaaatgttcctgcaatgacttctggtaa

DBGET integrated database retrieval system