KEGG   Arabidopsis thaliana (thale cress): AT4G14850Help
Entry
AT4G14850         CDS       T00041                                 

Gene name
LOI1
Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 DYW_deaminase PPR_1 PPR_3 PPR_long
Motif
Other DBs
NCBI-GeneID: 827142
NCBI-ProteinID: NP_193221
MIPS: AT4G14850.1
TAIR: AT4G14850
Araport: AT4G14850
UniProt: Q0WSH6
Position
4
AA seq 684 aa AA seqDB search
MSLLSADALGLLLKNAISASSMRLGRVVHARIVKTLDSPPPPFLANYLINMYSKLDHPES
ARLVLRLTPARNVVSWTSLISGLAQNGHFSTALVEFFEMRREGVVPNDFTFPCAFKAVAS
LRLPVTGKQIHALAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPERNLETWNAF
ISNSVTDGRPREAIEAFIEFRRIDGHPNSITFCAFLNACSDWLHLNLGMQLHGLVLRSGF
DTDVSVCNGLIDFYGKCKQIRSSEIIFTEMGTKNAVSWCSLVAAYVQNHEDEKASVLYLR
SRKDIVETSDFMISSVLSACAGMAGLELGRSIHAHAVKACVERTIFVGSALVDMYGKCGC
IEDSEQAFDEMPEKNLVTRNSLIGGYAHQGQVDMALALFEEMAPRGCGPTPNYMTFVSLL
SACSRAGAVENGMKIFDSMRSTYGIEPGAEHYSCIVDMLGRAGMVERAYEFIKKMPIQPT
ISVWGALQNACRMHGKPQLGLLAAENLFKLDPKDSGNHVLLSNTFAAAGRWAEANTVREE
LKGVGIKKGAGYSWITVKNQVHAFQAKDRSHILNKEIQTTLAKLRNEMEAAGYKPDLKLS
LYDLEEEEKAAEVSHHSEKLALAFGLLSLPLSVPIRITKNLRICGDCHSFFKFVSGSVKR
EIIVRDNNRFHRFKDGICSCKDYW
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctctccgcggacgcacttgggttacttctcaagaatgcaatctccgcgagt
tccatgcgtttgggtcgcgtcgttcacgcaagaatcgtcaaaaccctcgattcaccacca
cctccgtttctcgcgaactatctcatcaacatgtactcaaaactcgaccatccggaatca
gcccgactcgttctccgactcactcctgcacgaaacgtcgtctcttggacttcacttatc
tccggacttgctcagaacggtcatttctccaccgctttggttgaattcttcgagatgcga
cgagaaggtgttgttccaaatgacttcactttcccttgtgcttttaaagctgtggcttct
ctgcgtttacccgttactgggaagcagattcatgcgcttgctgtgaagtgtggtaggata
cttgatgtgtttgttgggtgtagtgcttttgatatgtattgcaaaactaggcttagagat
gatgcacggaagttgttcgatgaaattcctgagaggaaccttgaaacttggaatgctttt
atatctaactctgtgactgatggaaggcctagggaagctattgaagcgtttattgagttt
agaaggattgatgggcacccgaattcgataactttttgtgctttccttaatgcttgttcg
gattggttacacttgaatctaggaatgcagttacacgggcttgtgttacgaagtgggttt
gatacagacgtctctgtttgcaatgggttgattgatttctatggaaagtgtaagcagata
cgtagcagtgagattatctttactgaaatgggaactaaaaatgctgtttcttggtgttca
ttggttgctgcatatgtgcagaatcatgaggatgagaaggcgtctgtattatatttacgc
tcaaggaaggatattgttgagacctctgattttatgatatcaagtgttctgagtgcgtgt
gctggtatggctggtcttgagttgggaagatcgatacatgctcacgctgtgaaggcgtgt
gttgaaaggactatatttgttggaagtgccctcgttgacatgtatggaaaatgtggatgt
atagaagattcagaacaagcgtttgatgagatgcctgagaagaacttagtgactcggaat
tcattgatcggaggatatgctcatcagggtcaggttgatatggcattggctttatttgaa
gaaatggcaccacgtggatgtggtccaactccaaattatatgacttttgtgtccttgctt
tccgcttgtagtagagcaggggctgtggaaaatggtatgaagatatttgattcgatgagg
agtacttatggcattgagccaggggctgagcattattcatgcatcgtggacatgctaggg
cgagcgggaatggtagaacgggcttatgaattcataaagaaaatgccaattcaaccgaca
atttcggtttggggtgctcttcagaatgcttgtaggatgcatggtaagccacagctggga
ttactagcagctgagaaccttttcaaactcgaccctaaggattcaggcaaccacgttctg
ctttccaatacgtttgcagcggctgggaggtgggcggaagccaacaccgtaagagaggag
ctgaaaggcgtagggatcaagaaaggagccggatacagttggatcacagtgaagaaccaa
gtccatgcctttcaagccaaggacagatcccacatactgaacaaagaaattcaaacaacg
ctggccaagctaaggaacgaaatggaagctgcagggtacaaacccgacctgaaactctcg
ctttacgatctggaggaagaagaaaaagcagcagaagtctcgcaccacagtgagaaactg
gctctagcatttggattgttatctttaccactcagtgtcccaatcagaatcaccaagaac
cttagaatctgcggagattgccacagcttcttcaagtttgtctctgggagtgttaaacga
gagatcattgtgagagacaataaccggtttcatcggtttaaagatgggatatgttcttgt
aaggattattggtaa

DBGET integrated database retrieval system