KEGG   Arabidopsis thaliana (thale cress): AT4G15380Help
Entry
AT4G15380         CDS       T00041                                 

Gene name
CYP705A4
Definition
(RefSeq) cytochrome P450, family 705, subfamily A, polypeptide 4
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: p450 LUC7
Motif
Other DBs
NCBI-GeneID: 827204
NCBI-ProteinID: NP_193273
MIPS: AT4G15380.1
TAIR: AT4G15380
Araport: AT4G15380
UniProt: Q8L7H7
Position
4
AA seq 517 aa AA seqDB search
MAAMNMIDFQNCFIFILLCLFSRLCYSHFFKKPKDPRLHFDLPPSPPSLPIIGHLHLLLS
VLLHRSLQKLSTKYGSILYLRVFRFPVVLISSASIAYEIFRAHDLNISYRGFTPTDDSLF
AGSFSFISAPYGDYWKFMKKVLVTNVFGPQAHEQSRGVRADVLERFYGNLFDKAIKKQSV
EICAEALKLSNSSICKMIMGRSCSEERFRALATELDVLTKKLFFANMLRAWFKKLVVSLF
KKETTVISYRFDELLESILVEHEKKLDVHHQRTDLMDALLAAYRDENAEYKITRNHIKSI
IADLLFAGTENQVQTIQWAMAEIINNPNVLERLRGEIDSVVGKSRLIQETDLPKLPYLQA
VVKETIRLHPPGPFFLRFTKEGCRIRGFYVPENTSVVVNVYAVMRDPDAWEDPLVFKPER
FLASSRAEQEEERREKEIKYLPFGSGRRSCPGENLAYVIMGTAIGVMVQGFEWRTTEEKI
NMDEAVVGLSLTMAHPLKIIPVARTSNSLTSSLQKCL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaatgaacatgattgactttcaaaactgcttcatctttatcctcctatgtctc
ttctcacgactctgttattctcacttcttcaagaaaccaaaggaccctcgccttcacttt
gatttacctccgagccctccgtctcttcccatcatcggtcatctgcaccttcttctctct
gttctactccacagatctttacaaaaactctccaccaagtacggatctattctctatctc
cgagtctttaggttccctgtagtcctcatctcgtcagcctcaattgcatatgagatcttc
agggcacacgacctgaacatctcgtaccgcggtttcactccgaccgatgattcacttttt
gccggatctttcagctttatctctgctccctatggagattattggaagttcatgaagaag
gtcctagttacaaacgtttttgggccccaagcacacgagcagtcacgaggtgtccgtgca
gatgtgctagagcggttttatgggaatctgttcgataaagcgataaagaagcagagcgtg
gagatatgtgctgaagcgttgaagttatctaactccagcatctgcaagatgatcatgggg
aggagttgttcagaggagagattcagggctttggctaccgagttagatgttttgacaaag
aagctcttctttgcaaacatgttgcgagcatggtttaagaagcttgttgtctctctgttt
aaaaaagaaactacagttatttcctacagattcgatgagctgctcgaaagcattcttgtg
gaacacgaaaagaaactggacgtgcatcatcaacgtacggacttgatggacgcattgttg
gcagcttatcgggatgaaaatgcagagtataagatcacaaggaaccatatcaagtcaatt
attgcggatcttttatttgcaggcactgaaaaccaagtgcagacaatacaatgggcaatg
gcagagatcattaacaaccctaacgttcttgagagactgagaggagaaatcgatagcgtg
gtaggaaagtcaaggttgattcaagaaacggatttaccaaagctcccttatttgcaagct
gtggttaaggaaacgataagactgcacccgccggggcctttcttcttaaggttcacaaaa
gaagggtgtaggatcagagggttctatgtaccagagaacacgtcagtcgttgttaacgtt
tatgctgtgatgagggatcctgatgcttgggaggatcctcttgtgtttaagccagagagg
ttcttagcttcttcaagagcagaacaagaggaggagagaagagagaaagaaattaagtac
cttccttttggaagcggaagaagaagttgtcccggagaaaatctagcttatgtcattatg
ggaactgcaattggagtgatggtgcagggttttgagtggagaaccacagaagagaaaatt
aacatggacgaggctgttgtaggactgagcttgaccatggctcatcctcttaagatcatt
cctgttgctcgaacctcaaactctttaacttcgagtttgcaaaaatgtttgtga

DBGET integrated database retrieval system