KEGG   Arabidopsis thaliana (thale cress): AT4G16340Help
Entry
AT4G16340         CDS       T00041                                 

Gene name
SPK1
Definition
(RefSeq) guanyl-nucleotide exchange factors;GTPase binding;GTP binding protein
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G16340 (SPK1)
Membrane trafficking [BR:ath04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    AT4G16340 (SPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 827328
NCBI-ProteinID: NP_001319958
MIPS: AT4G16340.1
TAIR: AT4G16340
Araport: AT4G16340
UniProt: Q8SAB7
Position
4
AA seq 1830 aa AA seqDB search
MENNNLGLRFRKLPRQPLALPKLDPLLDENLEQWPHLNQLVQCYGTEWVKDVNKYGHYEN
IRPDSFQTQIFEGPDTDTETEIRLASARSATIEEDVASISGRPFSDPGSSKHFGQPPLPA
YEPAFDWENERAMIFGQRTPESPAASYSSGLKISVRVLSLAFQSGLVEPFFGSIALYNQE
RKEKLSEDFYFQIQPTEMQDAKLSSENRGVFYLDAPSASVCLLIQLEKTATEEGGVTSSV
YSRKEPVHLTEREKQKLQVWSRIMPYRESFAWAVVPLFDNNLTTNTGESASPSSPLAPSM
TASSSHDGVYEPIAKITSDGKQGYSGGSSVVVEISNLNKVKESYSEESIQDPKRKVHKPV
KGVLRLEIEKHRNGHGDFEDLSENGSIINDSLDPTDRLSDLTLMKCPSSSSGGPRNGCSK
WNSEDAKDVSRNLTSSCGTPDLNCYHAFDFCSTTRNEPFLHLFHCLYVYPVAVTLSRKRN
PFIRVELRKDDTDIRKQPLEAIYPREPGVSLQKWVHTQVAVGARAASYHDEIKVSLPATW
TPSHHLLFTFFHVDLQTKLEAPRPVVVGYASLPLSTYIHSRSDISLPVMRELVPHYLQES
TKERLDYLEDGKNIFKLRLRLCSSLYPTNERVRDFCLEYDRHTLQTRPPWGSELLQAINS
LKHVDSTALLQFLYPILNMLLHLIGNGGETLQVAAFRAMVDILTRVQQVSFDDADRNRFL
VTYVDYSFDDFGGNQPPVYPGLATVWGSLARSKAKGYRVGPVYDDVLSMAWFFLELIVKS
MALEQARLYDHNLPTGEDVPPMQLKESVFRCIMQLFDCLLTEVHERCKKGLSLAKRLNSS
LAFFCYDLLYIIEPCQVYELVSLYMDKFSGVCQSVLHECKLTFLQIISDHDLFVEMPGRD
PSDRNYLSSILIQELFLSLDHDELPLRAKGARILVILLCKHEFDARYQKAEDKLYIAQLY
FPFVGQILDEMPVFYNLNATEKREVLIGVLQIVRNLDDTSLVKAWQQSIARTRLYFKLME
ECLILFEHKKAADSILGGNNSRGPVSEGAGSPKYSERLSPAINNYLSEASRQEVRLEGTP
DNGYLWQRVNSQLASPSQPYSLREALAQAQSSRIGASAQALRESLHPILRQKLELWEENV
SATVSLQVLEITENFSSMAASHNIATDYGKLDCITTILTSFFSRNQSLAFWKAFFPIFNR
IFDLHGATLMARENDRFLKQIAFHLLRLAVYRNDSVRKRAVIGLQILVKSSLYFMQTARL
RALLTITLSELMSDVQVTHMKSDNTLEESGEARRLQQSLSEMADEAKSVNLLRECGLPDD
TLLIIPEKFTENRWSWAEVKHLSDSLVLALDASLGHALLGSVMAMDRYAAAESFYKLGMA
FAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVIMQALVARNDGVWSKDHVSALR
KICPMVSGEFTTEASAAEVEGYGASKLTVDSAVKYLQLANKLFSQAELYHFCASILELVI
PVYKSRKAYGQLAKCHTLLTNIYESILDQESNPIPFIDATYYRVGFYGEKFGKLDRKEYV
YREPRDVRLGDIMEKLSHIYESRMDSNHILHIIPDSRQVKAEDLQAGVCYLQITAVDAVM
EDEDLGSRRERIFSLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVLQTEGSF
PALVNRLLVTKSESLEFSPVENAIGMIETRTTALRNELEEPRSSDGDHLPRLQSLQRILQ
GSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHFRLIGEE
DQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5493 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaacaatcttggtcttcgatttcgtaagctacctcgtcagcctcttgctctc
cctaagctcgatcctttgcttgatgagaatctggaacaatggccacatttgaatcaattg
gttcaatgttatggcactgaatgggttaaagatgttaacaaatacggtcactatgaaaat
attcgacctgattctttccagactcagatttttgaaggacctgatactgatactgagact
gagattcgtcttgctagtgccaggagtgcaactattgaggaggatgttgccagtatttcc
gggaggccgttttctgatcctggatcctctaagcattttgggcaacctcctttacctgct
tatgaaccagcttttgactgggaaaatgaaagagctatgatttttggtcagagaactcct
gaatctcctgcagctagctattccagtggattgaagatctctgtcagagttttgtctcta
gcttttcagtctggcttagttgaaccattttttggctcgattgcattgtacaatcaagag
aggaaggagaaactctctgaggatttttatttccagattcagccgacggaaatgcaggat
gctaaactttcatctgaaaatcgtggagtattttatctagatgccccatcagcatcagtt
tgcctgcttattcaattagaaaaaacagcaactgaggaaggaggcgttacatcatctgtc
tattcccgtaaagagcctgtgcacttaactgagagggaaaagcaaaagttgcaggtctgg
tctcgcattatgccttaccgagagtcttttgcttgggcagttgttccgctttttgataat
aatctcaccacaaacactggtgaatctgcttcccctagcagtcctcttgctcctagtatg
actgcgtcaagttcccatgatggtgtttatgaaccaattgcaaagatcacatcagatgga
aagcaaggttattcaggtggaagttctgtcgtagttgaaatatctaatttaaataaagtt
aaagagagctactctgaagagtccattcaggaccccaaacggaaggttcacaaacctgtt
aaaggggttctaagactggaaattgagaaacatcggaatggacatggagactttgaagat
ctatctgagaatggaagtatcataaatgactcccttgatccaactgaccgcctcagtgac
ctgactcttatgaagtgtcccagttctagttctggtggaccccgtaatggctgttcaaag
tggaattcagaggatgcaaaggatgtttcgagaaatctaacaagttcatgtgggactcct
gacttaaattgttatcatgcttttgatttttgctctacgacaagaaacgagccttttcta
catctcttccattgcctttatgtgtatcctgtagctgttactttaagtcggaagaggaat
ccctttatccgtgtagaattgagaaaggatgacacagatatccgaaaacaaccactcgag
gcaatatatccaagagaacctggtgtttcactccagaaatgggttcatacacaggtcgct
gttggtgctagggccgctagctaccatgatgaaattaaggtctctcttcctgccacatgg
acgccatcacatcatctgttattcactttttttcatgttgatctccagacaaagcttgaa
gctccaagaccagtagttgttggatatgcatcacttccattatctacatatatccactca
cggtctgatatttctctaccagtaatgagagaacttgttccccactatcttcaggaaagc
accaaggagaggttggattatttggaagatggcaaaaatatttttaagttgcgactgaga
ctttgttcatctctttatcccaccaacgaacgtgtcagggatttctgtctagagtatgat
agacataccctccagacaaggcctccctggggttcagaactgttgcaggcaataaacagt
ttgaagcacgttgattctactgccttgcttcagtttctttacccaattcttaacatgctc
cttcatcttattggcaatggtggagaaacccttcaggttgcagcattcagagccatggtg
gatattttaactcgggtgcagcaggtgtcgtttgatgatgctgaccgaaatcgatttctg
gtcacctatgttgattattcttttgatgattttggaggcaatcaaccaccggtttatcct
ggattagcaactgtgtggggaagtttagctagaagcaaggccaaaggttaccgggttgga
cctgtatatgacgatgtattatcaatggcgtggtttttcctcgagttgattgttaaatca
atggcattggagcaagcacgtctttatgatcacaatctacctacaggcgaggatgttcca
cccatgcagctcaaagaaagtgttttccgatgtatcatgcaattgtttgattgtctttta
actgaagtacatgaacgttgtaaaaagggcttaagcttggcgaaacgtctgaacagcagt
ttggccttcttctgttatgatcttttatatatcattgagccctgccaggtctatgaactg
gtatcgttatacatggacaagttttctggtgtttgtcaatctgttctacacgaatgcaag
ctcacgtttttgcaaattatctccgaccatgatctttttgtagaaatgcctggtagagac
ccatcagacaggaactatttatcatccatattaatacaggagttatttctctcactggat
catgatgagctgcctctgcgggcgaagggagcaagaattttagtgatccttttatgcaag
catgaatttgatgcgcggtaccagaaagctgaagataagctgtatattgcacaactgtat
tttccttttgtcgggcagattttagatgaaatgcctgttttttataacctaaatgctact
gaaaagcgtgaggttttaattggtgtgctgcaaattgttcgtaatctggatgacacatca
cttgtcaaagcatggcagcagagcatcgctcgtactcgattatatttcaaactcatggaa
gaatgcctcatacttttcgagcacaagaaggctgctgacagcatcctcgggggcaacaat
tctcgtggtcctgttagtgaaggagctggatcaccaaagtactccgagcgactttctcct
gctatcaacaattatctgtcagaggcttctcgccaagaagtcaggctagagggaacacct
gataatgggtacctgtggcagagagttaattctcagttggcctcccctagccaaccttat
tctctaagagaagctttagctcaagcacaatcttcccggattggagcttcagcccaggca
ctaagagaatcgctgcacccaattttgaggcaaaaactggaactttgggaggagaatgta
agtgccactgttagcctccaggttttggagatcactgaaaatttttcatcaatggcagcc
tctcacaatattgcgaccgactatggcaaattggactgcattactacaatactgacgagt
ttcttctcccgaaaccagtcattagctttctggaaagccttctttccaattttcaacaga
atctttgatcttcatggggctacactgatggccagggaaaatgatcgcttcttaaaacag
atagccttccatcttctccggcttgctgtttaccgcaatgacagtgtcaggaaaagggct
gttattggtcttcaaatactagttaagagctcgctatactttatgcagactgctaggctg
agggctttgctgacgattacactgtcagaactcatgtcggatgtccaagtgactcatatg
aagtcagataatacattagaagagagtggagaagcacggcgacttcaacagtcattaagc
gaaatggctgatgaagctaagagtgtcaatttgttgagggagtgtggtcttcctgatgat
acactgttgattattcccgagaaatttacagagaaccgctggtcatgggctgaagtcaaa
catctttctgacagccttgttcttgctcttgatgccagcctcgggcatgcccttttggga
tctgtgatggctatggatcgatatgctgctgcagagagcttctacaaacttggaatggcg
tttgctcctgttccggatcttcacataatgtggttattgcatctatgtgatgcccaccag
gaaatgcagtcttgggcagaagctgcacagtgtgctgtggcggttgcaggtgtgataatg
caggccttggtggctaggaatgatggtgtgtggagcaaggatcatgtgtctgccttgcgt
aagatttgcccgatggtaagtggcgagtttacaacagaggcatctgcagctgaagtcgag
ggttatggtgcttcaaagctaacagttgactccgccgtcaagtatttacagcttgctaat
aagcttttctctcaagctgagctctaccatttttgtgcaagcattttagaacttgttatt
ccagtttacaagagcaggaaggcttatgggcagttggctaagtgtcacactttacttact
aatatatacgagtccattcttgaccaagaatcaaacccaatcccatttattgatgctaca
tattaccgggtgggattttatggggaaaagtttgggaagttggacaggaaagaatatgta
taccgagaaccacgagatgtgcggctaggggatataatggaaaaactgagccatatatat
gagtcaagaatggacagcaaccatattctgcacattataccagattcgaggcaagtgaag
gcagaagacttgcaggcaggagtgtgctatctgcaaattactgctgttgatgcagtgatg
gaagatgaggatcttgggagcagaagagagagaatattttctctttcaactggaagtgtt
cgagcacgagtgtttgatcgtttcttatttgacacaccatttacgaaaaatggtaaaacc
caaggtggattagaagatcaatggaagagaagaacagtgctgcagactgagggttcattc
cctgcccttgtgaataggctgttggttaccaagtctgaatcccttgaattctcgccagtg
gagaatgcgattggaatgattgaaacgcggacaaccgctctgagaaatgagctagaggag
cctcgtagctcggatggggatcacctaccacggcttcaaagtctgcagaggattctccaa
ggaagtgttgcagtgcaggtgaacagtggggtgttgagcgtgtgcacagctttcttatca
ggagagcctgcaacgagattgcgttcacaggaactgcagcaactaatcgcggcactgctt
gaattcatggcggtttgtaagcgagccattagggttcactttagattaatcggagaagaa
gatcaggaattccatactcagcttgtcaatggatttcagtctctcaccgcagaactctcc
cattacatccctgctatcttatccgaactttag

DBGET integrated database retrieval system