KEGG   Arabidopsis thaliana (thale cress): AT4G16470Help
Entry
AT4G16470         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_3 PPR_1 PPR_long DYW_deaminase
Motif
Other DBs
NCBI-GeneID: 827345
NCBI-ProteinID: NP_193380
MIPS: AT4G16470.1
TAIR: AT4G16470
Araport: AT4G16470
UniProt: O23491
Position
4
AA seq 501 aa AA seqDB search
MKTLISSSLSHKSQCLTICFKLNKLAMVYYTREFQTEASQTSASGSMFSGNATTILRRML
AEKRIGRFQVENQRKTEKLDKTLKGLCVTGRLKEAVGLLWSSGLQVEPETYAVLLQECKQ
RKEYTKGKRIHAQMFVVGFALNEYLKVKLLILYALSGDLQTAGILFRSLKIRDLIPWNAM
ISGYVQKGLEQEGLFIYYDMRQNRIVPDQYTFASVFRACSALDRLEHGKRAHAVMIKRCI
KSNIIVDSALVDMYFKCSSFSDGHRVFDQLSTRNVITWTSLISGYGYHGKVSEVLKCFEK
MKEEGCRPNPVTFLVVLTACNHGGLVDKGWEHFYSMKRDYGIEPEGQHYAAMVDTLGRAG
RLQEAYEFVMKSPCKEHPPVWGSLLGACRIHGNVKLLELAATKFLELDPTNGGNYVVFAN
GYASCGLREAASKVRRKMENAGVKKDPGYSQIELQGEVHRFMKDDTSHRLSEKIYKKVHE
MTSFFMDIDYYPDGLDSSCPV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttaatctcttcttctctttctcacaaatcccaatgtttgactatttgcttc
aagctgaataagcttgcaatggtttactacactcgggagttccaaacagaggcgtctcag
acgtcggcttccggttctatgttctccggaaatgcgacgacgatcctacgccggatgctt
gcagagaagagaattggaaggtttcaggtggagaatcagaggaaaacagagaagctagat
aagacattaaagggtctatgtgttacagggagattgaaagaagctgttgggttgttatgg
agtagcggattgcaagtagagcctgagacttatgctgtactgttgcaggaatgtaaacaa
aggaaggagtatacaaaagggaaacgtatacatgctcagatgtttgttgttggatttgct
ctcaatgagtatttgaaagttaagttgttgatactttacgccttatcaggtgatcttcaa
acagctgggattctctttcgtagtttgaagattagagatttgataccgtggaatgcaatg
atatctgggtatgtgcaaaaaggtttagagcaagaagggctttttatttattatgatatg
agacagaacagaatagttcctgatcagtatacatttgcttcagtgtttagagcttgttct
gcgttagatcggttggaacatggaaagagagctcacgctgtgatgataaagcggtgtatt
aagtcgaacattatagttgatagtgctcttgttgatatgtactttaaatgcagtagcttc
tctgatggccacagagtatttgatcaattgtccactagaaatgtgattacgtggacctca
ttgatatctggctatggatatcatggaaaagtttcagaggtgttaaaatgctttgaaaag
atgaaggaagaaggttgtagaccaaatccggttacttttttggtggttctcactgcgtgt
aaccatggaggtttagttgataaaggttgggagcatttctattctatgaagagagattac
gggattgaacctgagggacaacactatgctgctatggttgatacgttagggcgtgctggt
aggttacaagaagcgtatgaatttgtaatgaagtcaccatgcaaggagcatcccccagta
tggggttctttacttggggcttgcaggattcatgggaatgtgaaactgctagaactcgca
gctacaaaatttttagagttggatccaacaaatggagggaattacgttgtgtttgccaat
ggatacgcgagttgtggattacgtgaagctgcctcaaaggttaggaggaagatggagaat
gcaggagtgaaaaaagatcccgggtatagccagatagaattacaaggggaagttcataga
ttcatgaaggatgatacgtctcacagactctctgaaaagatatacaagaaggtccatgag
atgacttcattctttatggatattgactactatccagatggcttagactctagctgtcct
gtttga

DBGET integrated database retrieval system