KEGG   Arabidopsis thaliana (thale cress): AT4G16650Help
Entry
AT4G16650         CDS       T00041                                 

Definition
(RefSeq) O-fucosyltransferase family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: O-FucT
Motif
Other DBs
NCBI-GeneID: 827366
NCBI-ProteinID: NP_001319965
MIPS: AT4G16650.1
TAIR: AT4G16650
Araport: AT4G16650
UniProt: Q8LPF8 A0A178UUT3
Position
4
AA seq 549 aa AA seqDB search
MGVVAEVWRSSVRLLTNSPQLNGGSHKSALWKWRFFSAQPKRTVMWTWVCGFMLFSLGVI
SLFTGHVVSHLEWYSQQLSKRSLLDMSRREPIDVWKSKYSKFFYGCSERGRNFLPAVQEQ
SSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSYWKDDSDFSDIFDVNW
FISSLAKDVTIVKRVPDRVMRAMEKPPYTTRVPRKSTLEYYLDQVLPILTRRHVLQLTKF
DYRLANDLDEDMQKLRCRVNYHALRFTKRIQSVGMKVVKRMRKMAKRFIAVHLRFEPDML
AFSGCDFGGGEKERAELAEIRKRWDTLPDLDPLEERKRGKCPLTPHEVGLMLRALGFTND
TYIYVASGEIYGGEKTLKPLRELFPNFYTKEMLANDELKPLLPYSSRLAAIDYIVSDESD
VFITNNNGNMAKILAGRRRYMGHKRTIRPNAKKLSALFMDREKMEWQTFAKKVKSCQRGF
MGDPDEFKPGRGEFHEYPQSCICQRPFSYDKTSTDDEEEDMSEENHNSTSPGHVHLSSAD
NERDEVFPD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtagtagctgaggtttggaggtcgagcgtgaggctattaacgaactcgcctcag
cttaacggtggctctcacaagagtgcgttatggaagtggcgatttttctctgctcagccc
aaaagaaccgtaatgtggacatgggtttgtggtttcatgcttttctctttaggagtcatc
tcacttttcactggtcacgttgtctcgcaccttgagtggtattctcagcaattaagcaaa
cggagcttactggatatgagccgtcgagaaccaattgatgtatggaagtcaaaatattcg
aagtttttctatggatgcagtgagagaggaaggaacttccttcctgctgtccaggagcag
tcatctaatggatatttgcttattgcagctagtggaggccttaaccaacaaagaacagga
ataactgatgcagtggttgttgcacggattcttaatgctactttagttgtacccgagttg
gatcaccattcttactggaaagatgacagtgacttcagtgacatttttgatgttaactgg
ttcatatcttctctcgccaaagatgtgactatagtaaagagagttcccgacagagtcatg
cgtgcgatggagaaacctccttataccacacgtgtgcctcgaaagtctactcttgagtat
tatcttgaccaagtattgccaattctcacgaggagacatgttttacaattgacaaagttt
gactacagactagcaaatgatctagatgaagacatgcaaaagttgcgctgcagggtcaac
tatcatgctttaagattcacaaagcggatacaatcagttgggatgaaagtggtcaagagg
atgagaaagatggccaaacgttttattgctgtccatttgagatttgagcctgacatgcta
gccttttctggttgtgactttggtgggggtgaaaaagagagagctgagctagcagaaata
agaaaacgatgggacacattgcctgatctggaccctcttgaagaaagaaagcgtgggaaa
tgccctcttacacctcatgaagtgggcttaatgctgcgcgctcttggttttacaaacgac
acatatatctatgtcgcatctggagaaatatatggtggtgaaaagacactgaaaccactg
agagagctgtttccaaacttttacaccaaggaaatgcttgccaacgatgagctcaagcct
ctgcttccctattcttcacgccttgctgccattgactacattgttagtgacgaaagcgat
gtgtttatcactaataataatggaaatatggccaagattcttgcaggccgaaggaggtac
atgggtcacaagaggaccatcaggccaaatgcaaagaagctcagtgcattgttcatggac
cgggaaaagatggagtggcaaactttcgccaaaaaagtgaaatcttgtcaacgtggattc
atgggtgatccagatgagttcaaaccaggacgcggtgaattccacgagtacccgcaatct
tgcatttgtcagagacccttctcttacgacaaaacctcaacggatgatgaagaagaagac
atgtcagaagagaaccacaacagcaccagccctggacatgtacatttgtcttcagcagac
aatgagcgcgacgaagttttccctgactag

DBGET integrated database retrieval system