KEGG   Arabidopsis thaliana (thale cress): AT4G17160
Entry
AT4G17160         CDS       T00041                                 

Gene name
RABB1a
Definition
(RefSeq) RAB GTPase homolog B1A
  KO
K07877  Ras-related protein Rab-2A
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G17160 (RABB1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT4G17160 (RABB1a)
   04031 GTP-binding proteins [BR:ath04031]
    AT4G17160 (RABB1a)
Membrane trafficking [BR:ath04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    AT4G17160 (RABB1a)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT4G17160 (RABB1a)
  Exosomal proteins of other body fluids (saliva and urine)
   AT4G17160 (RABB1a)
  Exosomal proteins of colorectal cancer cells
   AT4G17160 (RABB1a)
GTP-binding proteins [BR:ath04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    AT4G17160 (RABB1a)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_22 CPT Alpha_TIF AAA_24 ABC_tran TetR_C_16 AAA_29
Other DBs
NCBI-GeneID: 827427
NCBI-ProteinID: NP_193449
MIPS: AT4G17160.1
TAIR: AT4G17160
UniProt: O23561 A0A178UXW9
Position
4
AA seq 205 aa
MSYAYRFKYIIIGDTGVGKSCLLLKFTDKRFQAVHDLTIGVEFGAKTITIDNKPIKLQIW
DTAGQESFRSVTRSYYRGRAGTLLVYDITRRETFNHLASWLEEARQHASENMTTMLIGNK
CDLEDKRTVSTEEGEQFAREHGLIFMEASAKTAHNVEEAFVETAATIYKRIQDGVVDEAN
EPGITPGPFGGKDASSSQQRRGCCG
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtcttatgcttatagatttaagtatatcatcatcggtgatactggagtagggaaatca
tgccttctgcttaagttcaccgacaagaggtttcaagcagtgcatgatctcaccattggt
gttgaatttggggccaagacgatcactatcgacaacaaacccatcaaacttcagatctgg
gatacggctggtcaagaatcatttaggtctgttacaaggtcatactatagagggcgtgcc
ggtacattgcttgtatatgatatcacaaggagggagacatttaaccatctagccagctgg
ctagaagaggcaagacagcatgcaagtgaaaatatgacgacaatgctcattgggaataag
tgtgatcttgaagataaaaggacagtgagtacagaggaaggagaacagtttgctagggag
catggtcttatattcatggaggcctctgctaagactgctcacaatgtcgaggaggcattc
gtcgagacagccgcaacaatatacaaaaggattcaagatggtgtggttgatgaggcaaat
gagcctggaataactccagggccgtttggtggaaaagatgcatcctcctcacagcaaaga
agagggtgctgcggctga

DBGET integrated database retrieval system