KEGG   Arabidopsis thaliana (thale cress): AT4G17330Help
Entry
AT4G17330         CDS       T00041                                 

Definition
(RefSeq) G2484-1 protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Agenet ZirS_C DUF2073
Motif
Other DBs
NCBI-GeneID: 827445
NCBI-ProteinID: NP_001329269
MIPS: AT4G17330.1
TAIR: AT4G17330
Araport: AT4G17330
UniProt: F4JP43
Position
4
AA seq 2037 aa AA seqDB search
MDYDDSDFQNQNLHLAGEANNKFPPVLQPYALPKFDFDDTLNTHLRFDSLGESEAFLGIE
GNEDNNWIEDFSRGSSGIVFSSGATESCAISRHNNVWSEATSSESVAMLLNSVGQDEVIV
REDTIKKSDTSHELGCTMETVEPGQTSHERSLSKEETVNLQPNPSVDDTPGESSVVKTDD
GQEQVLVKDDSPTAVEEASVEEKNSILTSNTATVEAIDTTDLGKIGTETTDNLLDQTEEK
ANVESRMEDDCSDGNVQTIITCSGELNNQSTLLPETSNDENVISDHIQSSYNRNDLTADA
RSILVEGHSDSHIDSASEVEKVEAENIGKTAKPDLKEIELSDVTVLERGDQAPSTLEVGG
QDVSGTECQDLLVSTVHTSVAVEASLELAGELTTITNSVSIEKPELLSHQHMEVITSEHE
STFQIETETYPQIHVFETSESVYISTMDSMVEAREGGVSKKSDNEGSARTSNLEQSMELP
VNANDRDQDVKNSQILSESVVSGSVGYVSGGSTSELAESESQSDSIPTDKSETMIDSSLN
LEELQPLSQDGAPAVSLTSSIDLHMVKTSSDDSDQGSYSETKKVYGEPENGQTVPPVDAS
CSGSQMDQEARKRAEGTKQSTYSVEGCPRSEGSKDAVDADGVGQVLQQQSEELIFEENVV
TEAVKAPETLSVLDKDNKNEMPITSSLPILGSEAGKDGQEEDNTAASGGIMAAGTPVTHP
KGDAIVLGDSRASTCSESSVKSYVTAIEDAATNLKTPLDSFPTVKTSELQFNNTETNSVK
KPEDQNISGFMSAGSPVLNRNETSSSEMNLTPDQLKAGKISKAVIFSQATLVSPIVVGSP
STSSLDKTAAKSSKAKSERKPRRTSKSVGKETSRKGTSVKGATPIEQFQSGGKTNAVNQS
LASHIQITQSTEKQRSLQSPALKAFGSLSTPTASLPDLNSSALSSILRRPFTDLQQVQLR
AQIFVYGALIQGTAPDEAYMISAFGGADGGKGSWEKSWRTCVVRAQKSLVATPETPLQSR
PGKTETPSAGHTNSKESSGTNPMIPLSSPLWSLSTSVDTLQSSSVQRGSAATHQPLLSAS
HAHQTPPTQNIVGHNTPWMSPLPFRNAWLASQQTSGFDVGSRFPVYPITDPVKLTPMKES
SMTLSGAKHVQSGTSSNVSKVTPTLEPTSTVVAPAQHSTRVKSRKRKKMPVSVESGPNIL
NSLKQTELAASPLVPFTPTPANLGYNAGTLPSVVSMTAVPMDLVSTFPGKKIKSSFPSPI
FGGNLVREVKQRSVLSEDTIEKLKEAKMHAEDASALATAAVSHSEYVWKQIEQQSHAGLQ
PETQDRLASAAVAIAAAAAVAKAAAAAANVAANAALQAKLMAEEASLPNASDQGLPKSYD
SILPGQGTPASILKGEGAVVNSSSVLIAAREASKKRVEAATAATKRAENMDSIVKAAELA
SEAVSQAGILVSMGHPPLLNKLVEAGPSNYWRQAQESQEVQPCKTVVLEKETVSTSEGTF
AGPKIVQTEFGGSVNTADGVSGPVPATGKLKGQEGDKYADLAKNNDVVFEPEVGSKFSID
AQQTIKATKNEDIKEGSNVEVFKEEPGLRTAWYSANVLSLEDDKAYVLFSDLSVEQGTDK
LKEWVALKGEGDQAPKIRPARSVTALPYEGTRKRRRAALGDHIWKIGDRVDSWVHDSWLE
GVITEKNKKDENTVTVHFPAEEETLTIKAWNLRPSLVWKDGKWIECSSSGETISSSHEGD
TPKEKRPRLGTPALVAEVKDTSMKIVDDPDLGKPPQTGVLNLGVSENTFNIGKSTREENK
PDPLRMKRTGLQKQGSKVIFGVPKPGKKRKFMDVSKHYVSEASTKTQERKEPVKPVRSIV
PQNSGIGSWKMPSKTISIEKQTTISRPKTFKPAPKPKEKPGATARIIPRKDSRNTTASDM
ESDESAENRGPGSGVSFKGTVEEQTTSSSHDTGSKNSSSLSTNKGRVAPTAGRLAKIEED
KALAENSSKTSEGMEPRRSIRRIQPTSRLLEGLQTSMMTSKIPSVSHSKSHLSQSKK
NT seq 6114 nt NT seq  +upstreamnt  +downstreamnt
atggattatgatgacagtgactttcaaaaccagaatctccatttagctggtgaagccaac
aacaaatttccaccagttttacagccttatgctcttccaaagtttgattttgatgataca
ctcaacacgcatctgaggtttgatagtttaggtgaatctgaagcttttcttggtattgag
ggtaacgaagataataactggattgaggatttctctcgtggaagtagtggtatagtgttt
agttcaggtgcaacggagtcctgtgccatttctaggcacaataatgtttggtctgaggct
acttcgtcggaatctgttgcaatgcttttgaattcagttggacaggacgaagttattgta
agagaggatactatcaagaaatctgacacttctcatgaactaggctgcacaatggaaaca
gtagagcctggtcagacatcccatgaaagaagtctttccaaagaggaaacggtgaactta
caacccaacccctctgtggatgatactccaggagagtcctctgtggtaaagacagatgat
ggacaggagcaggttctggttaaagatgactcaccaacggctgtagaagaggcatctgtg
gaggaaaagaattccatcttgacttctaataccgcgacggtagaggctatagatactact
gatcttggtaaaataggaactgagacgacggataatcttcttgaccaaacagaagagaaa
gccaatgtagaatcaaggatggaagatgattgtagcgatgggaatgtacagactattatt
acttgtagcggtgagttgaataatcagagcactttacttccagagacttccaatgatgaa
aatgttatcagcgaccacattcaaagtagttataaccgcaatgatctaactgcagatgca
cggtcaattttggttgaaggtcattctgatagccatatagactcagcttccgaagttgaa
aaagtggaagctgaaaatattggcaaaactgcaaagcctgatttgaaggagatagagcta
tctgatgtcacagtactagaaagaggggaccaagctccctctactcttgaggtaggtgga
caagatgtttctgggaccgaatgccaagatctccttgtcagcactgttcatactagcgta
gctgttgaagcgtctttggaacttgctggggaattgacaactataacaaacagtgtttcc
attgagaagcccgagttgcttagtcatcaacatatggaagttattacaagtgaacatgag
tctacttttcagatagagactgagacatatccgcagatacacgtatttgaaacttcagag
agtgtttatatttcaacgatggactcaatggttgaagctagagaaggtggtgtgtctaag
aagagtgacaatgaaggtagtgctcgcacttctaatctcgagcaaagcatggaactgcct
gtcaatgccaatgatagagatcaagatgtcaagaactctcagatcctatctgaaagcgtt
gtgtctggttctgttggctatgtttcaggaggctctacttcagagttggcggagtcagaa
tctcaatctgacagcattccaacagacaagtcagagactatgattgacagttctctcaat
ctcgaagaattacaacctctaagtcaagatggagcacctgctgtcagtctcacatcttca
atagatttacatatggtaaagacatcctctgatgacagtgaccaaggcagttactctgaa
accaagaaggtttatggtgaacctgaaaatggtcaaaccgttccacctgtggatgcaagt
tgttcagggagtcagatggaccaagaagctaggaagcgtgctgaaggtactaagcaaagt
acatactctgttgaaggctgtcctcgctctgaagggtcaaaggatgcagtagatgctgat
ggtgttggacaagttttgcagcagcagtctgaggaattaatttttgaagagaatgtagta
acagaagctgtaaaagctcctgagactctgtcagttctggacaaggataacaaaaatgaa
atgcctattactagctccttgcctattcttgggagtgaagctggaaaagatggccaggaa
gaggataatactgctgcttctggtgggattatggcagctgggactcctgttacacacccc
aaaggtgatgcaatcgtactaggagactcccgtgcttctacatgttctgagtcttctgta
aagtcttatgtaactgcaatagaagatgctgctactaatttaaagactcctcttgattct
ttccccactgttaagacttccgaacttcaatttaataacacagagacaaacagtgtcaaa
aagccagaagatcagaatatttcgggttttatgtctgctggatctccggtcttgaataga
aatgagacctccagcagtgaaatgaacttaactcctgatcagctgaaagcagggaaaatt
tccaaagctgttatattttcacaagctacccttgtctccccgattgtggtgggatctcct
tcaacatctagcttagataaaacagctgcaaagtcttccaaagcaaaatctgagcggaaa
cccaggcgaacatctaaatctgtaggaaaagagacttctagaaaaggaactagtgtaaaa
ggggctacacctattgaacagtttcaaagtggaggcaaaacaaatgctgttaatcaaagt
ttggcttctcatattcagatcacacaatctactgagaaacagcgaagtcttcagagccct
gctctaaaagcttttgggtccctttcaacccctacggcaagtctaccggatttgaactct
tctgctctctcaagtattctgcgtcgacctttcacggacttgcaacaagtgcaactacgt
gcacagatttttgtatacggggctctgatccaaggaacagcaccggatgaagcttatatg
atatctgcatttggtggtgcagatggtgggaagggcagctgggagaaatcatggcgtact
tgtgttgtaagggctcagaaatcgcttgttgctactcctgaaacgccactgcaatcacgt
ccagggaagacagagaccccttcagcaggtcacaccaatagcaaagagagttcagggaca
aaccccatgattccactctcatcacctttatggagtttatcaacttccgtagatacttta
caatcaagtagcgttcagagaggttcagctgctactcaccagccattgctttctgcatcg
catgctcaccaaactccaccaactcagaatattgttggacataataccccttggatgtcg
cctctccctttccgtaacgcttggcttgcttctcagcaaaccagtggatttgatgttggt
tcccgtttccccgtctatccaatcactgaccctgtaaaattgactcccatgaaagaatca
tccatgactctttctggcgcaaaacatgttcagagtggaacttctagcaatgtttccaaa
gtgacaccaacacttgagcctactagtacagttgtagcacctgctcaacattctacaagg
gtaaaatcaaggaaacggaagaagatgccagtctctgtggagtctggtccaaacattttg
aattcgttaaagcagacagaattagctgcctcacctcttgtgccttttacacctactccg
gctaatctgggttataatgctggcaccctgcccagtgttgtttctatgactgcagtccct
atggacctggtatctacgttccccgggaagaaaataaaatcatctttcccatctccaatt
tttggtggtaaccttgtacgtgaagtaaagcagagatctgtcttgtcagaggatactatt
gaaaaacttaaggaggctaagatgcatgcagaggatgcatctgctcttgctactgcagct
gttagtcatagcgaatatgtatggaagcagatagagcaacaaagtcatgctggcctccag
ccagaaactcaagacagattagcttcggctgctgttgccatagctgctgcagctgcggtg
gcaaaagctgcagctgctgccgccaatgttgcagctaatgctgcattgcaggccaagtta
atggctgaagaagcatcccttccaaatgcttctgatcagggactcccaaagtcatatgat
agcatattacccggtcagggtacccctgcttctatcttgaagggtgaaggtgcagtggtg
aactccagttcggttcttattgctgcgagagaggcatctaagaagagggttgaagctgct
acagcggccaccaagcgtgctgaaaatatggactccattgtaaaagcagcagaattggca
tcagaggctgtttctcaagctggaatacttgtttcaatgggtcatcctccgttgctcaat
aagctggtggaggcgggtccaagtaattactggaggcaggctcaagaatctcaggaagta
cagccctgtaaaacggttgtcttagaaaaagaaactgtgtctactagtgagggaactttt
gctggtcccaaaattgtgcagactgagtttggtggctctgtgaatacggcagatggtgtg
tccggtccagttcctgccactggaaagttaaagggacaggagggtgataaatatgcagac
ttggctaaaaacaatgatgtggtttttgaaccagaagttgggtcaaaattttcaattgac
gcccaacagactatcaaagcaacaaagaatgaggacatcaaggagggttctaatgtagag
gttttcaaagaagaacctggattaagaaccgcatggtactctgccaatgtattgagctta
gaggatgataaagcttacgtgttgttcagtgacctatctgtagaacaaggaacagacaag
cttaaggagtgggtagccctcaaaggggaaggtgatcaggcccctaaaataagacctgct
cgttctgttactgccttgccatatgaaggaaccaggaagagacgtagagctgctcttggg
gatcatatttggaaaattggggatagggtagactcgtgggtgcatgacagttggttggag
ggtgttatcacagagaagaacaagaaagatgaaaacacagtgactgtgcattttcctgcg
gaagaagaaactttgacgatcaaagcttggaatcttcgtccttctcttgtgtggaaagat
ggaaagtggattgaatgttctagttcaggagaaactatcagctcgtcacatgagggtgat
actccaaaggagaagcgtcctagattaggaactcccgctcttgtggctgaagtaaaagac
acgagtatgaagattgttgatgatccagacttggggaaaccgcctcagactggtgttctt
aacctcggtgtttcagagaatacttttaacattggaaagagtaccagagaggagaacaaa
cccgatccactccgaatgaagagaaccggtttgcaaaagcaaggatcaaaagtgattttt
ggtgtccctaaacctggaaagaaaaggaagttcatggacgtgagcaaacactatgtttca
gaggcaagcactaaaactcaggaaaggaaggaaccagttaagcctgtgagatcaattgtg
ccccaaaattctggaataggtagctggaaaatgccttctaaaactatctccatagagaaa
cagacaacaatatctaggcccaagactttcaaacctgcgcccaagcccaaagagaaaccg
ggtgctacggctaggataattccccgcaaggactcgcgtaatacaacagcatcagatatg
gaatctgatgagagtgcagaaaacaggggtcctggatctggtgtttcatttaagggaaca
gtagaagagcaaaccacatcatcctctcatgatactggttcgaagaatagttcctccttg
agcactaataaagggagagtggctcctactgcaggaaggttagccaaaatcgaagaggac
aaggcgttggctgaaaattcttcaaaaacatcagagggaatggagccacgtagatctatc
cgcaggatccagccaacttctagactactcgaaggtctgcaaacgtcgatgatgacctcg
aagattccttcggtatcacacagcaaaagtcacctaagtcaaagcaaaaagtag

DBGET integrated database retrieval system