KEGG   Arabidopsis thaliana (thale cress): AT4G17350Help
Entry
AT4G17350         CDS       T00041                                 

Definition
(RefSeq) auxin canalization protein (DUF828)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Auxin_canalis PH_2
Motif
Other DBs
NCBI-GeneID: 827447
NCBI-ProteinID: NP_193466
MIPS: AT4G17350.1
TAIR: AT4G17350
Araport: AT4G17350
UniProt: Q5U1F1
Position
4
AA seq 405 aa AA seqDB search
MESGFYSDWKDTSSSSFFGSENMEEELEDGVLRAEELFSSIPQPQTPKEPMEFLSRSWSL
STSEISKALALKHRQQQDQFCVGQNSPPVLFPDAAADPLVAGKIMNSVGTRRAGTLSKWF
HHNKEHSTSSTTTNLKKKDKVRVENAHVHSAVSIAALAAGLASVTSASNCKGSGSKMALA
LASATELLASHCVEMAERAGADHARVTSTVRSSVDIHSPGDLMTLTAAAATALRGEAALK
ARQPKEARKNAAITPFERSFSDSHWHANFQYRLEEPNLPFEGELMQCARNGVQRTKRVCV
YINKKSQVMIKLKSKHVGGAFSKKIKCVVYGVCDEKSAWPYRKERENSEEVYFGLKTGQG
LLEFKCKSKIHKQRWVDGVQSLLRQVNCFEAAKCSLGSLNLTGHT
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtggcttttattcagattggaaagatacttcttcttcttcgttctttggatca
gagaatatggaggaagagttggaagatggagttcttagagctgaagagcttttctcatcg
attcctcaacctcagacacctaaagagccaatggagtttctgtctagatcctggagtctc
tctacttctgaaatctccaaagcacttgctctcaaacatagacaacaacaagatcagttt
tgtgttggccagaacagtcctcctgttttgttccctgatgctgctgcagatccactcgtg
gctgggaagatcatgaactctgttggcacacgtagagcagggacattgtctaaatggttt
caccacaacaaggaacacagcaccagcagtactactaccaatctcaagaagaaagataaa
gtgcgtgtggagaacgcccacgtgcattctgccgtctctatagcggctctggctgcaggt
ttagcctctgtgacatctgctagcaattgcaaagggtcaggctccaagatggcactggct
ttagcctcagccactgaactgttggcctcacactgtgttgagatggctgagcgagccggt
gctgaccatgcacgtgttacttccacggttagatcttctgtggatatccacagccccggt
gatctcatgactctaacagccgctgctgcaactgctttgagaggagaagcggctctgaag
gcgaggcagccaaaggaagcaaggaaaaatgcagctattaccccttttgagagaagtttc
tctgattctcattggcatgcaaattttcagtatagattggaagaaccaaatcttccattt
gaaggcgaactgatgcaatgtgcacgaaatggagtgcagcgaactaagcgtgtctgtgtc
tatatcaacaagaagtctcaggtaatgatcaaactcaaaagcaaacatgttggaggggca
ttctctaagaaaatcaaatgcgttgtctatggagtctgcgatgagaaatcagcttggcct
tacaggaaagagagggaaaattcagaagaagtctacttcggtctgaaaaccggacaaggt
cttttggagttcaagtgcaagagcaagattcacaagcagagatgggttgatggggttcag
tctcttctccgccaagtaaattgctttgaggctgccaaatgctcgctgggatctctgaat
ctcactggtcacacgtga

DBGET integrated database retrieval system