KEGG   Arabidopsis thaliana (thale cress): AT4G17380Help
Entry
AT4G17380         CDS       T00041                                 

Gene name
MSH4
Definition
(RefSeq) MUTS-like protein 4
  KO
K08740  DNA mismatch repair protein MSH4
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G17380 (MSH4)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutS homologs specialized for meiosis
     AT4G17380 (MSH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutS_V MutS_III MutS_IV MutS_II
Motif
Other DBs
NCBI-GeneID: 827450
NCBI-ProteinID: NP_193469
MIPS: AT4G17380.1
TAIR: AT4G17380
Araport: AT4G17380
UniProt: F4JP48
Position
4
AA seq 792 aa AA seqDB search
MEDDGGERSSFVAGLIENRAKEVGMAAFDLRSASLHLSQYIETSSSYQNTKTLLRFYDPS
VIIVPPNKLAADGMVGVSELVDRCYSTVRKVVFARGCFDDTKGAVLIQNLAAEEPLALGL
DTYYKQHYLSLAAAAATIKWIEAEKGVIVTNHSLTVTFNGSFDHMNIDATSVENLELIDP
FHNALLGTSNKKRSLFQMFKTTKTAGGTRLLRANLLQPLKDIETINTRLDCLDELMSNEQ
LFFGLSQVLRKFPKETDRVLCHFCFKPKKVTEAVIGFENTRKSQNMISSIILLKTALDAL
PILAKVLKDAKCFLLANVYKSVCENDRYASIRKKIGEVIDDDVLHARVPFVARTQQCFAL
KAGIDGFLDIARRTFCDTSEAIHNLASKYREEFNLPNLKLPFNNRQGFFFRIPQKEVQGK
LPNKFTQVVKHGKNIHCSSLELASLNVRNKSAAGECFIRTETCLEALMDAIREDISALTL
LAEVLCLLDMIVNSFAHTISTKPVDRYSRPELTDSGPLAIDAGRHPILESIHNDFVSNSI
FMSEATNMLVVMGPNMSGKSTYLQQVCLVVILAQIGCYVPARFATIRVVDRIFTRMGTMD
NLESNSSTFMTEMRETAFIMQNVTNRSLIVMDELGRATSSSDGLAMAWSCCEYLLSLKAY
TVFATHMDSLAELATIYPNVKVLHFYVDIRDNRLDFKFQLRDGTLHVPHYGLLLAEVAGL
PSTVIDTARIITKRITDKENKRIELNCGKHHEIHRIYRVAQRLICLKYSRQTEDSIRQAL
QNLNESFTEERL
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgacggaggagagagatcgagtttcgtcgccggcctaattgagaacagagcc
aaagaggttggaatggctgcttttgacctaagatcggcttcactgcatctatctcagtat
atagagacaagcagctcataccaaaacacgaagacgctgttgcgtttctatgatccttct
gtgataattgttcctcccaacaaattggcagccgatggcatggttggggtatcggaactg
gtggatagatgttatagcaccgttaggaaggttgtgtttgcccgtggctgttttgatgac
accaagggtgctgtgctaatacaaaacttggcagcagaagaacctttggcgcttggttta
gacacttactataagcagcattatctctcattggctgctgctgctgctacaatcaaatgg
atagaggcggaaaagggtgtgatagtcaccaaccactcactgactgtaacttttaatgga
tcgtttgatcacatgaatatcgatgcaactagtgttgagaatctggaactcattgatcca
ttccacaacgcacttttgggcactagcaacaaaaagaggagtttgttccagatgttcaag
acaacaaaaacagctggcgggactaggcttcttcgcgcaaacttgttacagcctctgaaa
gatattgaaactattaacactcgcctggactgcctggatgagttgatgagcaatgaacaa
ctattctttgggctttcacaagttttacgaaaatttccaaaagagactgatcgagttctt
tgtcatttctgcttcaagccaaagaaagtcactgaagcggtcataggttttgaaaatacc
agaaagagccaaaacatgatttcaagcattatcttacttaagactgcattggatgcttta
cctatacttgcaaaggttctgaaggacgcaaagtgttttcttcttgccaatgtttacaag
tcagtgtgtgaaaatgatagatatgcttccatcagaaaaaaaatcggggaagttattgat
gatgatgtcctccatgcacgggttccgtttgttgcccgtacacagcagtgttttgcttta
aaagccggaattgatggatttttggatattgcaagaagaaccttctgtgatactagtgaa
gcaatacataatctggccagtaagtatcgtgaggaattcaacttgccaaatttgaaactc
cctttcaacaacaggcagggattctttttcagaattcctcagaaggaagttcagggaaaa
cttccgaacaaattcactcaggttgtaaaacatgggaaaaacatacattgttcgagtctg
gaactggcttctttgaatgtcaggaataagtctgccgctggagagtgtttcattcgaacg
gaaacatgcttggaagcactaatggatgctataagggaagatatctctgccctcacactc
ctagcagaagtcttatgtctcctagatatgattgttaattcatttgctcatacaatatcc
acaaagccagtggatcgatactctagacctgaactaacagatagtggcccactggcaatt
gatgctggaaggcatcccatcctagaaagcatacacaacgactttgtttctaatagtata
ttcatgtcagaagcaaccaacatgttggtagttatgggtccaaacatgagcggaaagagc
acatatctccaacaggtgtgtctagtagtcattcttgctcagattggttgctatgtccca
gctcgctttgcaactataagggtggttgaccgcatatttacaagaatggggacaatggat
aaccttgagtcgaattccagcacgtttatgacggagatgagagagaccgctttcataatg
cagaatgtcaccaataggagtctgatagtcatggatgaactcgggagggctacttcttcc
tcagacgggttagcaatggcatggagctgctgcgagtatctcttatcactcaaagcgtac
acagtatttgcaacccatatggacagtctcgcagagttagcaaccatctacccaaatgtc
aaggttcttcatttttatgtagacatcagagataaccgcttagacttcaagtttcaactg
cgagatggaaccctacatgttccacattatggccttctattagctgaagtggcgggtctg
cctagtacagtgatcgatacagctaggatcataaccaaaaggatcacagacaaagaaaat
aaaagaatagagctaaattgtgggaagcaccacgaaatacatcggatctaccgagttgct
caaaggttgatatgcttgaaatactctagacagacagaagactcaattcgtcaagcactc
caaaatctgaatgaaagcttcactgaagaaagactctaa

DBGET integrated database retrieval system