KEGG   Arabidopsis thaliana (thale cress): AT4G17500Help
Entry
AT4G17500         CDS       T00041                                 

Gene name
ERF-1
Definition
(RefSeq) ethylene responsive element binding factor 1
  KO
K09286  EREBP-like factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT4G17500 (ERF-1)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   EREBP
    AT4G17500 (ERF-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AP2
Motif
Other DBs
NCBI-GeneID: 827464
NCBI-ProteinID: NP_567530
MIPS: AT4G17500.1
TAIR: AT4G17500
Araport: AT4G17500
UniProt: O80337
Structure
PDB: 

Position
4
AA seq 268 aa AA seqDB search
MSMTADSQSDYAFLESIRRHLLGESEPILSESTASSVTQSCVTGQSIKPVYGRNPSFSKL
YPCFTESWGDLPLKENDSEDMLVYGILNDAFHGGWEPSSSSSDEDRSSFPSVKIETPESF
AAVDSVPVKKEKTSPVSAAVTAAKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFET
AEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPVRIKSKRSSFSSSNENGAPKKRRTV
AAGGGMDKGLTVKCEVVEVARGDRLLVL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgacggcggattctcaatctgattatgcttttcttgagtccatacgacgacac
ttactaggagaatcggagccgatactcagtgagtcgacagcgagttcggttactcaatct
tgtgtaaccggtcagagcattaaaccggtgtacggacgaaaccctagctttagcaaactg
tatccttgcttcaccgagagctggggagatttgccgttgaaagaaaacgattctgaggat
atgttagtttacggtatcctcaacgacgcctttcacggcggttgggagccgtcttcttcg
tcttccgacgaagatcgtagctctttcccgagtgttaagatcgagactccggagagtttc
gcggcggtggattctgttccggtcaagaaggagaagacgagtcctgtttcggcggcggtg
acggcggcgaagggaaagcattatagaggagtgagacaaaggccgtgggggaaatttgcg
gcggagattagagacccggcgaagaacggagctagggtttggttaggaacgtttgagacg
gcggaggacgcggcgttggcttacgacagagctgctttcaggatgcgtggttcccgcgct
ttgttgaattttccgttgagagttaattcaggagaacccgacccggttcgaatcaagtcc
aagagatcttctttttcttcttctaacgagaacggagctccgaagaagaggagaacggtg
gccgccggtggtggaatggataagggattgacggtgaagtgcgaggttgttgaagtggca
cgtggcgatcgtttattggttttataa

DBGET integrated database retrieval system