KEGG   Arabidopsis thaliana (thale cress): AT4G18810
Entry
AT4G18810         CDS       T00041                                 
Name
(RefSeq) NAD(P)-binding Rossmann-fold superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: CIA30 NAD_binding_10 NmrA Epimerase TrkA_N adh_short CBM_11
Other DBs
NCBI-GeneID: 827615
NCBI-ProteinID: NP_001190764
TAIR: AT4G18810
UniProt: F4JRN8
Position
4:complement(10322060..10325906)
AA seq 627 aa
MEVSSSLKLSSSLSPSIIKLQGSSSSIDIKFSKYTSLPKPFLQLDDKSRRLRDQQVSHSL
ELRSYRKRVTAKSGSQGWDFGRFVKTLYFFNGPPSPLKFVSSVFEKLTNGATEEPVAEMG
TSGIILVAGATGGVGRRIVDILRKRGLPVKALVRNEEKARKMLGPEIDLIVADITKENTL
VPEKFKGVRKVINAVSVIVGPKEGDTPERQKYNQGVRFFEPEIKGDSPELVEYIGMKNLI
NAVRDGVGLENGKLIFGVGDNTFKDLPWGALDDVVMGGVSESNFIVDLTAGENGGPTGIF
KGIVSTTNNGGFTSVRTKNFPEAENVSAYDGLELRLKGDGLRYKLIVRTSQDWDTVGYTA
SFDTSPGQWQSVRLPFSSLRPVFRARTVTDAPPFNASSIISLQLMFSKFEYDGKLNPTFK
EGPFELPLSSIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTY
KLKGEDLIRDSGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESP
YALNKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKTLKDGITGKEALEQSTVAKSSPL
KRWRPDTACLVIKLKLRHVNVLLKKFV
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggaggtttcgtcttcactcaagctctcatcgtcgttatctccttccatcatcaaactt
cagggttcttcatcaagtattgatataaaattctctaagtacacttcacttcctaaaccg
tttcttcaacttgatgataaaagccgacgtcttcgtgaccaacaagtttcacattctctc
gagctaaggtcttacagaaaacgggtcactgcgaaatcaggttctcaaggttgggacttt
ggtagattcgtcaaaacattgtactttttcaatggaccaccatctcctctaaagtttgtt
tcatcggtgtttgagaaacttactaacggagcaacggaggaaccggttgctgaaatggga
acttctggaatcatacttgtggctggagctactggtggtgtaggaagaaggattgttgat
atcttgaggaaaagagggttgcctgttaaagcattggttagaaatgaagagaaggctcgg
aagatgttaggacctgagattgacttgattgttgcagatattacaaaggagaatacattg
gttcctgaaaagttcaaaggagtgaggaaagtgatcaatgctgtttctgttattgttggt
ccaaaggaaggagatacacctgagagacaaaaatataatcagggagtcaggttcttcgag
ccagagataaaaggcgactctcccgagttagtggaatacattggaatgaagaacttaatc
aatgctgttagagatggtgttggacttgagaatgggaagcttatttttggtgtcggggat
aacacgtttaaggatctaccttggggagcattggatgatgttgtaatgggaggtgtcagc
gaaagtaacttcatagtagatctaaccgctggtgaaaacggtggacctaccggaattttt
aaaggaattgtttccacaacaaataatggcggatttacgagtgtccgaaccaagaacttt
cccgaggcggagaatgtctctgcatatgatggtctagagctaagactaaaaggtgatgga
ctccgttataagctaatcgtccgaacaagccaagattgggatactgttggttacaccgcc
agttttgacacttcaccaggccaatggcaatctgtacgcttacctttctcgtctttaaga
cctgtatttcgcgcacgtacagttacagatgcaccaccttttaatgcaagcagtatcatt
tcactacagcttatgtttagcaaatttgagtatgatggtaagcttaaccctacattcaaa
gaaggacctttcgagcttcctttatctagcattcgagcttatatccaagaccccgtcact
ccaaggtttgttcacgttggctctgcgggagttactcgaccagagagacccggtttggat
ctaagcaaacaacctccggccgtgagattaaacaaagagcttgatttcattctcacttac
aagttaaagggagaggatctgatacgcgacagcgggattccatttgcaattgtacggcca
tgtgctttaacagaagagcctgccggagctgatctcattttcgaacaaggagacaacatt
acggggaaggtatcaagagacgaagtagcgcgtatatgcatcgctgctttagaaagcccg
tatgctcttaacaagaccttcgaggttaaaagtacggttccgtttagcgagcctttcacg
gtagatcctgagaatcctccaccggagaaagactacaatgagtatttcaagactctgaaa
gatggaatcaccggtaaagaagctttagaacagagcactgttgcaaaaagcagtccgttg
aaacggtggagaccagataccgcttgtctggtaatcaaactgaaactcagacacgtcaat
gtacttctgaagaagtttgtctga

DBGET integrated database retrieval system