KEGG   Arabidopsis thaliana (thale cress): AT4G19210Help
Entry
AT4G19210         CDS       T00041                                 

Gene name
ABCE2
Definition
(RefSeq) RNAse l inhibitor protein 2
  KO
K06174  ATP-binding cassette, sub-family E, member 1
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Ribosome biogenesis [BR:ath03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    AT4G19210 (ABCE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran RLI SMC_N AAA_21 Fer4 AAA_15 Fer4_10 AAA_29 Fer4_6 RsgA_GTPase AAA_16 AAA Fer4_7 NACHT AAA_22 AAA_23 Fer4_2 TsaE SRP54 Fer4_21 AAA_33 AAA_24 Thymidylate_kin Fer4_9 Fer4_16 Rad17 Fer4_8 TniB Fer4_4
Motif
Other DBs
NCBI-GeneID: 827661
NCBI-ProteinID: NP_193656
MIPS: AT4G19210.1
TAIR: AT4G19210
Araport: AT4G19210
UniProt: Q8LPJ4 A0A178UZT9
Position
4
AA seq 605 aa AA seqDB search
MADRLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCGI
CVKKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL
KILAGKLKPNLGRFTSPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRAV
KGNVGEVLDQKDERDKKAELCADLELNQVIDRDVENLSGGELQRFAIAVVAIQNAEIYMF
DEPSSYLDVKQRLKAAQVVRSLLRPNSYVIVVEHDLSVLDYLSDFICCLYGKPGAYGVVT
LPFSVREGINIFLAGFVPTENLRFRDESLTFKVAETPQESAEEIQSYARYKYPTMTKTQG
NFRLRVSEGEFTDSQIIVMLGENGTGKTTFIRMLAGLLKPDDTEGPDREIPEFNVSYKPQ
KISPKFQNSVRHLLHQKIRDSYMHPQFMSDVMKPLQIEQLMDQEVVNLSGGELQRVALTL
CLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIMATYLADRVIV
YEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSY
YYLDD
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcgattgacacgtattgctattgtgagttcagaccgttgcaagccaaagaaa
tgtcgccaagagtgcaagaagagttgtcctgtggtcaagacaggaaaactttgtattgag
gtgactgttggttccaagcttgcttttatctcagaggagttgtgtatcggttgcggtatt
tgtgtgaagaaatgcccgtttgaagctattcagattatcaatcttccaagagacttggag
aaagatacgacccatcgttatggggcaaacacttttaagttacacaggctcccagttcca
agaccagggcaggtgctagggttggttggaaccaatggtattggaaaatcaactgctctg
aaaattttggctggaaagctcaaaccaaatttgggccgtttcactagtcctccagactgg
caagaaatcttgactcacttccgtggttcagaacttcaaaactacttcacacgtattcta
gaagataatcttaaggccattataaagcctcaatatgtcgaccacatcccaagagcagtt
aaaggcaatgttggagaggtccttgaccagaaggatgagagagataagaaggcagagctc
tgtgctgatctggagctgaaccaggtcattgaccgtgatgttgagaatttatctggtggt
gagctgcagaggtttgcaatcgctgttgttgccatacaaaatgcagagatttacatgttt
gatgaaccatctagttacctcgatgttaagcaaagactcaaagctgctcaagttgttcgt
tctctcctgaggcctaatagctacgtcattgttgtggagcatgatctcagtgttcttgat
tacttgtcggatttcatttgctgtctgtatgggaaaccaggagcctatggtgtggtgact
ctccccttctctgtcagagaaggaatcaacattttcttggctggatttgttcctacagaa
aatttacgttttagagatgaatctttgaccttcaaggttgctgagactccacaagaaagt
gctgaagagatacagtcgtacgctaggtacaaataccccacgatgaccaaaactcaagga
aacttcaggttgagagtgtcggaaggtgaattcactgactctcagattattgtaatgctt
ggggagaatggtacagggaagacaacatttattcggatgctggccgggttgttgaaacca
gacgacacagaaggaccagacagagagataccagaattcaatgtttcgtataagccacaa
aagatcagcccaaagtttcagaattcagttaggcacctgctacatcaaaagattcgagat
tcttacatgcatccacaatttatgtcggatgtgatgaaaccacttcagattgagcagttg
atggatcaagaagttgtcaatctctcaggaggagaattgcaaagggttgcattaactctg
tgcctcggaaagcctgcggatatatacctgatcgatgagccaagtgcatatctcgattct
gagcaacgtattgttgcttctaaagtcataaagcgatttattctccacgcaaagaaaact
gcatttgtagtcgagcatgactttataatggcgacctatttggcagaccgggtcattgtg
tatgaaggacaaccatccattgattgtactgcaaattgtcctcaatcactgctcagtgga
atgaatctcttcttatctcatctgaacatcacattcagacgggatcccaccaatttcaga
ccaagaatcaacaaattggagtcgaccaaagacagggaacagaagtctgcaggctcatac
tactacttggatgattag

DBGET integrated database retrieval system