KEGG   Arabidopsis thaliana (thale cress): AT4G20360
Entry
AT4G20360         CDS       T00041                                 
Symbol
RABE1b
Name
(RefSeq) RAB GTPase homolog E1B
  KO
K02358  elongation factor Tu
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT4G20360 (RABE1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ath03012]
    AT4G20360 (RABE1b)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT4G20360 (RABE1b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT4G20360 (RABE1b)
Translation factors [BR:ath03012]
 Eukaryotic type
  Elongation factors
   AT4G20360 (RABE1b)
 Prokaryotic type
   AT4G20360 (RABE1b)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AT4G20360 (RABE1b)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT4G20360 (RABE1b)
  Exosomal proteins of breast cancer cells
   AT4G20360 (RABE1b)
  Exosomal proteins of colorectal cancer cells
   AT4G20360 (RABE1b)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Other DBs
NCBI-GeneID: 827784
NCBI-ProteinID: NP_001329775
TAIR: AT4G20360
UniProt: P17745 A0A178UY83
Position
4:10989910..10992509
AA seq 476 aa
MAISAPAACSSSSRILCSYSSPSPSLCPAISTSGKLKTLTLSSSFLPSYSLTTTSASQST
RRSFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDEIDAA
PEERARGITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPM
PQTKEHILLAKQVGVPDMVVFLNKEDQVDDAELLELVELEVRELLSSYEFNGDDIPIISG
SALLAVETLTENPKVKRGDNKWVDKIYELMDAVDDYIPIPQRQTELPFLLAVEDVFSITG
RGTVATGRVERGTVKVGETVDLVGLRETRSYTVTGVEMFQKILDEALAGDNVGLLLRGIQ
KADIQRGMVLAKPGSITPHTKFEAIIYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVT
KIMNDKDEESKMVMPGDRVKIVVELIVPVACEQGMRFAIREGGKTVGAGVIGTILE
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcgatttcggctccagccgcttgttcttcctcctctagaattctctgttcctactcc
tctccttctccttctctctgtcccgccatttccacctctggtaaactcaaaaccctaact
ctctcttcctccttcctcccttcttactcattaaccaccacctccgcttctcaatccact
cgtcgctccttcaccgtccgcgccgctcgtggaaagttcgagaggaagaagcctcatgtc
aacatcggaaccatcggtcatgttgaccatgggaaaactactttaaccgcagctctaacc
atggctctcgcttccattggttccagcgtcgctaaaaagtacgacgagattgacgctgcg
ccggaggagagagctcgtggtatcacaatcaacactgctactgttgagtacgagactgag
aatcgtcactacgctcacgttgattgtcctggtcacgctgattacgttaagaatatgatt
accggagctgcacagatggacggagctatcctcgttgtttccggcgccgatggtcctatg
cctcagactaaagagcatatccttttggctaagcaggttggtgttcctgatatggttgtg
tttcttaacaaagaggatcaagtagatgatgcagagttgctagagctcgttgagcttgag
gttcgtgagcttctctcgtcttatgaatttaacggtgatgatattccgattatctctggt
tctgctcttttagccgttgagactcttactgagaatcctaaggttaagagaggtgataac
aaatgggtagataagatttatgaacttatggatgctgttgatgattacatccctatccct
cagagacaaactgaattgccattcttgttagctgttgaggatgtgttctctatcactgga
cgtggtacggtggctacagggcgtgtcgagagaggtacggttaaggtaggagagactgta
gatttagtgggtttgagggagactaggagttacactgtcactggggttgaaatgtttcag
aagattcttgatgaggctttagctggtgacaatgtagggttgttgcttaggggtattcaa
aaggctgatattcagagaggtatggttttagctaagccgggatcgattactccacatacc
aagtttgaagcaattatctatgtgttgaagaaagaggaaggtggaaggcattctccattc
tttgcagggtacaggcctcagttctacatgaggacgactgatgttacgggtaaagtgacg
aagatcatgaacgacaaagatgaagagtcgaagatggttatgcccggtgatcgagtgaag
attgttgttgagcttattgtgccggtggcttgtgaacaagggatgaggtttgctatcaga
gaaggaggaaagactgttggtgctggagttattgggacgatcctcgaatga

DBGET integrated database retrieval system