KEGG   Arabidopsis thaliana (thale cress): AT4G20770Help
Entry
AT4G20770         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 PPR_long TPR_17
Motif
Other DBs
NCBI-GeneID: 827825
NCBI-ProteinID: NP_193809
MIPS: AT4G20770.1
TAIR: AT4G20770
Araport: AT4G20770
UniProt: Q9SVH0
Position
4
AA seq 774 aa AA seqDB search
MRSGGNKYLASLLRCYRDERCKLSGKVIHGFIVRMGMKSDTYLCNRLLDLYIECGDGDYA
RKVFDEMSVRDVYSWNAFLTFRCKVGDLGEACEVFDGMPERDVVSWNNMISVLVRKGFEE
KALVVYKRMVCDGFLPSRFTLASVLSACSKVLDGVFGMRCHGVAVKTGLDKNIFVGNALL
SMYAKCGFIVDYGVRVFESLSQPNEVSYTAVIGGLARENKVLEAVQMFRLMCEKGVQVDS
VCLSNILSISAPREGCDSLSEIYGNELGKQIHCLALRLGFGGDLHLNNSLLEIYAKNKDM
NGAELIFAEMPEVNVVSWNIMIVGFGQEYRSDKSVEFLTRMRDSGFQPNEVTCISVLGAC
FRSGDVETGRRIFSSIPQPSVSAWNAMLSGYSNYEHYEEAISNFRQMQFQNLKPDKTTLS
VILSSCARLRFLEGGKQIHGVVIRTEISKNSHIVSGLIAVYSECEKMEISECIFDDCINE
LDIACWNSMISGFRHNMLDTKALILFRRMHQTAVLCPNETSFATVLSSCSRLCSLLHGRQ
FHGLVVKSGYVSDSFVETALTDMYCKCGEIDSARQFFDAVLRKNTVIWNEMIHGYGHNGR
GDEAVGLYRKMISSGEKPDGITFVSVLTACSHSGLVETGLEILSSMQRIHGIEPELDHYI
CIVDCLGRAGRLEDAEKLAEATPYKSSSVLWEILLSSCRVHGDVSLARRVAEKLMRLDPQ
SSAAYVLLSNTYSSLRQWDDSAALQGLMNKNRVHKTPGQSWTTYGNDLDSGFRK
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagcggagggaataagtatttagcgagtctcttgcgttgttatagagatgaaagg
tgtaaactttctgggaaagttatacatgggttcattgttaggatgggaatgaagagtgat
acttatctatgtaatcgtttacttgatttgtatattgagtgtggtgatggggattatgca
cggaaggtgtttgatgaaatgtctgtaagagatgtttattcttggaatgcttttttgacg
tttagatgtaaagttggggatttgggggaagcgtgtgaggtgtttgatggaatgcctgag
agagatgttgtgtcgtggaataatatgattagtgttttggtgaggaaagggtttgaagag
aaggctttggttgtctataagaggatggtttgtgatgggtttttgccttctcggttcacg
ttagctagtgttttaagtgcgtgtagcaaggttttggatggtgtttttggtatgaggtgt
catggggttgctgttaaaacgggtcttgataagaatatttttgttgggaatgcgttgttg
tctatgtatgcaaagtgtgggtttattgttgattatggtgttcgagtctttgaatctctc
tctcagcctaatgaagtctcttatacagcggtgattggcgggttagctcgggaaaataaa
gtgttggaggcagttcagatgttcagattgatgtgcgagaaaggcgtgcaggtggattct
gtttgcttatctaatattcttagcatctctgctccaagagaaggatgtgatagcctgagt
gaaatctatggcaatgagcttgggaaacagattcattgtcttgctttgagacttgggttt
ggaggagatcttcatctgaacaattcgttgcttgaaatatatgcaaagaataaagacatg
aatggtgcagagctaatttttgctgagatgcctgaagtgaatgttgtctcttggaacata
atgatagttgggtttggtcaggagtatcgaagtgacaaatctgttgaattcctaacgaga
atgagagattctggttttcaaccaaatgaagttacttgcattagtgttcttggagcgtgc
tttcgttcaggggatgtcgaaaccggaaggagaatattcagtagcattccccagccaagt
gttagcgcttggaatgctatgctttctggttattccaactatgaacactatgaggaagca
ataagcaatttcagacaaatgcagtttcagaacctgaaacctgataaaaccactttgagt
gtgatattaagttcgtgtgcgagattgagatttctggaaggagggaagcagatccatggg
gtagtgataaggaccgagatttcgaagaacagtcacatagttagtggtcttattgcagtg
tactccgaatgcgagaagatggagatatctgaatgtatctttgatgattgtataaacgaa
ttggatatcgcttgttggaactcgatgatctcaggttttagacacaacatgctggacaca
aaagctctaatactctttagaaggatgcatcagactgccgtgttgtgtcctaatgaaact
tcattcgctactgtactaagtagctgttcaaggttatgtagtttgctccatggaagacag
tttcatggactggtagtgaagagtggatatgtaagtgattcctttgttgaaaccgctctt
accgacatgtactgcaagtgtggggaaatagattcagctcgacagttcttcgatgctgtt
ttgaggaaaaacacggttatttggaatgagatgatacatgggtatggtcataatggacga
ggtgatgaagctgttggtctctacagaaagatgatttcatcaggagagaagcctgatggg
ataaccttcgtttctgtcttgactgcttgtagccactcaggactggtggaaaccgggctt
gagatacttagttcgatgcagagaattcatggaattgagccggagctggatcattacatc
tgtatagttgattgtcttggaagagctggccggcttgaagatgcagagaagcttgcagaa
gctacaccatacaaaagtagctctgttctatgggagattctactaagttcatgtagagtc
catggagatgtgagcttggctagacgagttgcagaaaaactaatgcgtctggatcctcag
agctcagcagcatatgtgctgctaagcaacacatatagttctttgagacagtgggatgat
tctgcagctcttcaaggattaatgaacaagaacagagttcataaaactccaggtcaaagc
tggaccacatatggcaatgatttggactcagggtttcgaaaatag

DBGET integrated database retrieval system