KEGG   Arabidopsis thaliana (thale cress): AT4G21440Help
Entry
AT4G21440         CDS       T00041                                 

Gene name
MYB102
Definition
(RefSeq) MYB-like 102
  KO
K09422  transcription factor MYB, plant
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT4G21440 (MYB102)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    AT4G21440 (MYB102)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 SLIDE
Motif
Other DBs
NCBI-GeneID: 826916
NCBI-ProteinID: NP_567626
MIPS: AT4G21440.1
TAIR: AT4G21440
Araport: AT4G21440
UniProt: Q9LDR8
Position
4
AA seq 350 aa AA seqDB search
MARSPCCEKNGLKKGPWTSEEDQKLVDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY
LRPDIKRGRFSFEEEETIIQLHSFLGNKWSAIAARLPGRTDNEIKNFWNTHIRKKLLRMG
IDPVTHSPRLDLLDISSILASSLYNSSSHHMNMSRLMMDTNRRHHQQHPLVNPEILKLAT
SLFSQNQNQNLVVDHDSRTQEKQTVYSQTGVNQYQTNQYFENTITQELQSSMPPFPNEAR
QFNNMDHHFNGFGEQNLVSTSTTSVQDCYNPSFNDYSSSNFVLDPSYSDQSFNFANSVLN
TPSSSPSPTTLNSSYINSSSCSTEDEIESYCSNLMKFDIPDFLDVNGFII
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggtcaccttgttgcgagaagaacggactcaagaaagggccttggacatctgaa
gaagaccagaagcttgttgactatatccagaaacatggttatggtaactggagaaccctc
cccaaaaatgccggtttgcaaagatgtggcaaaagttgtaggttaaggtggactaattat
ctccgaccagatataaagcgaggaaggttctcttttgaggaagaagaaaccattattcag
cttcatagcttcttaggaaacaagtggtctgcgattgcggcgcgtttaccaggaagaaca
gataatgagatcaagaacttttggaacactcatataagaaagaagctacttagaatgggg
attgatccagtgactcacagtccacgactcgatctcctcgatatctcatccatcttagct
tcatctctatacaattcatcttcacatcacatgaacatgtcaagactcatgatggatact
aatcgtcgtcatcaccagcaacatccattggttaaccccgagatactcaagctcgctacc
tctctcttctctcaaaatcaaaaccaaaaccttgtggtggatcatgactcgagaactcaa
gagaagcaaacagtttatagccaaaccggagtaaaccaataccaaaccaaccaatatttc
gagaacacgattactcaagaactccaatcttccatgccaccattccccaatgaagctcgt
cagtttaacaacatggatcatcacttcaatggttttggagaacaaaatcttgtttcaact
tctactacgtcagtccaagattgctataatccgtcattcaacgattattcaagttcaaat
tttgtcttggatccttcttattcggatcagagcttcaacttcgcaaattcggtcttaaac
acgccatcctcgagcccgagcccgactacgttaaactcgagttacatcaatagtagcagt
tgcagcactgaggatgaaatagaaagctattgcagtaatctcatgaagtttgatattccc
gatttcttggacgttaatggttttattatataa

DBGET integrated database retrieval system