KEGG   Arabidopsis thaliana (thale cress): AT4G21490Help
Entry
AT4G21490         CDS       T00041                                 

Gene name
NDB3
Definition
(RefSeq) NAD(P)H dehydrogenase B3
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT4G21490 (NDB3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     AT4G21490 (NDB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_7 Pyr_redox_3 EF-hand_8 NAD_binding_7 EF-hand_5 p25-alpha DUF1858 EF-hand_10 BET
Motif
Other DBs
NCBI-GeneID: 828234
NCBI-ProteinID: NP_193880
MIPS: AT4G21490.1
TAIR: AT4G21490
Araport: AT4G21490
UniProt: F4JJJ3
Position
4
AA seq 580 aa AA seqDB search
MRPFAYFERLSQAFHDYPSLSKILVVSTISGGGLIVYSEANPSYSNNGVETKTRKRKVVL
LGTGWAGASFLKTLNNSSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIARKQ
NVEMSFLEAECFKIDPGSKKVYCRSKQGVNSKGKKEFDVDYDYLVIATGAQSNTFNIPGV
EENCHFLKEVEDAQRIRSTVIDSFEKASLPGLNEQERKRMLHFVVVGGGPTGVEFASELH
DFVNEDLVKLYPKAKNLVQITLLEAADHILTMFDKRITEFAEEKFTRDGIDVKLGSMVVK
VNDKEISAKTKAGEVSTIPYGMIVWSTGIGTRPVIKDFMKQIGQGNRRALATDEWLRVEG
CDNIYALGDCATINQRKVMEDIAAIFKKADKENSGTLTMKEFHEVMSDICDRYPQVELYL
KSKGMHGITDLLKQAQAENGSNKSVELDIEELKSALCQVDSQVKLLPATGQVAAQQGTYL
AKCFDRMEVCEKNPEGPIRIRGEGRHRFRPFRYRHLGQFAPLGGEQTAAQLPGDWVSIGH
SSQWLWYSVYASKQVSWRTRVLVVSDWMRRFIFGRDSSRI
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagacctttcgcctacttcgaaagattatcccaagctttccatgattatccttctctc
tccaaaattctcgtcgtctccaccatcagtggtgggggacttatagtttactctgaggca
aatccatcatatagcaacaatggtgttgaaactaaaaccaggaagagaaaagtagtgctg
ctcggaactggatgggctggagcaagttttttgaagactttgaataactcttcttatgag
gttcaggttatatctcctcgaaactactttgctttcactcccttgttacctagtgttact
tgtggaactgttgaagctcgcagcgttgttgaacctattcgcaacattgcaagaaagcag
aatgttgagatgtctttcttggaggcagaatgtttcaaaattgatccaggaagcaagaaa
gtttactgccgatcaaaacaaggcgtgaattcgaaagggaagaaagagtttgatgttgac
tatgactaccttgtaatcgctactggagctcagtctaacacatttaacattcctggcgtg
gaggagaactgtcatttcctcaaagaggttgaagatgcacagagaattcgtagtactgtc
attgattcatttgagaaggcaagtttacctggactaaacgaacaagagagaaagagaatg
ctacattttgtagttgttggtggtggaccaacaggtgttgagtttgcttctgagcttcat
gattttgttaacgaggatctagtcaaactatatcctaaagccaaaaacttagtgcagatc
actcttctagaggctgcagaccacatcttgaccatgtttgacaagagaatcacagagttt
gctgaagaaaaatttactagagatggtattgatgtgaaattaggttctatggtggtcaaa
gtgaatgataaggaaatttctgcaaaaaccaaagcaggagaggtctcaactattccttat
ggaatgattgtttggtcaactggtattgggactcgtcctgtgatcaaagattttatgaaa
caaattggtcagggcaatagacgtgctttagcaaccgatgaatggcttcgtgttgaagga
tgtgataatatatatgcacttggtgattgtgcaacaatcaaccagagaaaagtcatggaa
gacatagctgctatattcaagaaagcagataaggaaaattcaggaacactgacaatgaaa
gaatttcatgaagtaatgagtgacatatgtgatagataccctcaagtggagctctacttg
aagagtaaaggtatgcatggcattaccgatcttctaaaacaagcacaagctgagaatggt
tccaacaagtctgtcgaactcgatatagaagaacttaaatcagctctttgtcaagttgac
tcacaagtgaagcttctaccagcgacaggacaggtcgctgctcaacaagggacttacctt
gcaaaatgctttgatcgtatggaagtatgcgagaagaatcctgaaggtcccattaggatt
agaggagaaggtcgtcaccgcttccgtcccttcaggtatagacatttgggacaatttgct
ccattaggaggcgaacaaaccgcggcgcaacttccaggagactgggtttcgataggacac
agcagtcaatggctgtggtactccgtttacgctagtaagcaagtgagctggcgaacgaga
gtcctggtggtctcagactggatgagacgattcatcttcgggagggattcaagtcgcatt
tga

DBGET integrated database retrieval system