KEGG   Arabidopsis thaliana (thale cress): AT4G21970Help
Entry
AT4G21970         CDS       T00041                                 

Definition
(RefSeq) senescence regulator (Protein of unknown function, DUF584)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Senescence_reg
Motif
Other DBs
NCBI-GeneID: 828286
NCBI-ProteinID: NP_193928
MIPS: AT4G21970.1
TAIR: AT4G21970
Araport: AT4G21970
UniProt: A0A178UYC2 F4JKD1
Position
4
AA seq 157 aa AA seqDB search
MEGGEEFQEEEVWSVLRESETQGPEMKMSKSNNLFSASSSSSARYIPKGNEVSGGAKQSS
APMNIPDWSKVYGYSKKNTSSHLHSWAIDDDDEGSMVPPHELVAKRLARTQISSFSMCEG
IGRTLKGRDLSKTRNAVLTRTGFLESNITSSSTTSPP
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggaagggggagaagagtttcaagaagaagaagtgtggtcagttttgagagaaagtgaa
actcaaggtcctgaaatgaaaatgtccaaaagtaacaatctcttctcagcctcttcctca
tcttctgcgaggtacattcctaaaggcaacgaggtctctggaggggcaaaacagtcatct
gctccaatgaatattcctgactggtccaaggtttatgggtattcaaagaagaacacaagc
agccacttgcattcatgggccattgacgatgatgatgaaggctcaatggttcctccacat
gagttagtagcaaaaagacttgcaagaacgcagatctcatcattctctatgtgcgaagga
atcggaagaacgctcaaaggaagagatctcagcaaaacaagaaacgctgtcttaacaaga
actggtttcttggaatcgaatatcacatcttcatcaacaacatcaccaccatag

DBGET integrated database retrieval system