KEGG   Arabidopsis thaliana (thale cress): AT4G22090Help
Entry
AT4G22090         CDS       T00041                                 

Definition
(RefSeq) Pectin lyase-like superfamily protein
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT4G22090
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     AT4G22090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pec_lyase_C Beta_helix NosD
Motif
Other DBs
NCBI-GeneID: 828298
NCBI-ProteinID: NP_193940
MIPS: AT4G22090.1
TAIR: AT4G22090
Araport: AT4G22090
UniProt: O65457
Position
4
AA seq 394 aa AA seqDB search
MTHFTVSCLLVALFLCQSLVHAAYNGYYGYSPAAAPYPAEEPQNIMNPVDSCWRLKSDWD
VNREDLADCAVGFGSSTLGGKKGNIYVVTNPYDNAQNPHPGSLRYGVIQAKPLWITFAKD
MVITLANELMVNSYKTIDGRGAKVEIAYGPCITIQDVTNVIVHGISIHDCKPGKSGKVRS
SPTHVGHRKGSDGDAITIFGSSNVWIDHCYLASCTDGLIDVIHASTAITISNNYFTQHDK
VMLLGHNDNFVKDVKMKVTVAFNHFGPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSA
DPTIFSEGNYFIASDKSYSKEVTKREVKGGWNNWRWRTSNDVFKNGAFFVPSGYGSIPLP
YSSAQRFTVAPGNLVPSLTADAGPLNCNRNGPCY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactcatttcaccgtttcgtgcctcctcgtggcactattcttatgtcagtccttggtc
catgccgcatataacggttattacgggtatagccccgcggctgcaccctaccccgccgaa
gaacctcagaacatcatgaatccggtggactcctgttggcggctcaagtctgactgggat
gtcaatcgtgaagacctagcagattgcgcggttgggtttggttcatctaccttgggtggc
aagaaaggtaatatatatgttgtcacaaacccttacgacaatgcacaaaacccccaccca
ggttctttgcggtacggcgtgatccaagccaagccattgtggattactttcgctaaggat
atggtcataaccctagcgaatgagctcatggtcaatagctataagaccatagatgggcga
ggggcaaaagtagaaattgcatacggaccatgcatcacgatacaagacgtgacgaacgtc
attgtgcatgggatcagtatccacgactgcaaaccagggaaatctggaaaggtgaggagc
agcccgacgcatgtcggtcaccgtaagggatcggacggtgatgccatcactatttttggt
tcgtcgaatgtttggatcgatcattgttacctagcgagttgtacggacggactcatcgat
gtaatccatgcttccacggcaatcactatttccaacaactatttcactcagcatgacaaa
gtgatgttgctcggacacaacgataattttgtgaaagatgtgaaaatgaaagtgaccgtg
gcattcaatcattttggaccaggacttgtggagagaatgccaagggtaagacgaggctac
gctcatgtggcaaacaatagatacgataaatggataatgtatgcaattggtggtagcgcc
gatcccaccattttcagtgaaggcaactatttcattgcttctgataaatcttacagcaaa
gaggtgacgaagagagaagtaaaaggaggatggaacaattggagatggagaacctcaaac
gatgttttcaagaacggagctttcttcgtaccttctggttatggcagcattccgctaccg
tacagttctgctcagcgattcacagtcgctcccggaaacttggttccttctttaaccgca
gacgctggccctctaaactgcaaccgcaacggtccttgttattag

DBGET integrated database retrieval system