KEGG   Arabidopsis thaliana (thale cress): AT4G22220Help
Entry
AT4G22220         CDS       T00041                                 

Gene name
ISU1
Definition
(RefSeq) SufE/NifU family protein
  KO
K22068  iron-sulfur cluster assembly enzyme ISCU, mitochondrial
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT4G22220 (ISU1)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    AT4G22220 (ISU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NifU_N
Motif
Other DBs
NCBI-GeneID: 828316
NCBI-ProteinID: NP_193953
MIPS: AT4G22220.1
TAIR: AT4G22220
Araport: AT4G22220
UniProt: O49627 A0A178UZH3
Position
4
AA seq 167 aa AA seqDB search
MMLKQAAKKALGLTSRQSTPWSVGILRTYHENVIDHYDNPRNVGSFDKNDPNVGTGLVGA
PACGDVMKLQIKVDEKTGQIVDARFKTFGCGSAIASSSVATEWVKGKAMEDVLTIKNTEI
AKHLSLPPVKLHCSMLAEDAIKAAVKDYKEKRVKTNGAAAAGETTQA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaagcaagctgcgaagaaggccctagggcttacgtcacgtcaatcaacaccg
tggtctgttggtatcctccgaacctaccatgagaacgtcatcgaccactacgataatccc
cgcaacgttgggtctttcgataagaatgatcccaacgttggtacgggactcgtaggagct
cccgcttgtggtgatgtgatgaagcttcaaatcaaggtcgatgagaagactggtcaaatc
gttgatgctcgctttaagacttttggttgtggttcagccatcgcttcttcatctgttgcc
actgaatgggtgaaaggcaaagctatggaggatgttctgaccatcaaaaacaccgaaatc
gcaaagcatctttctctcccaccagtcaagctccactgcagtatgttggcggaggacgct
atcaaggcagctgtgaaagactacaaggagaagcgtgtgaagacaaatggtgctgcagca
gcaggagaaaccacacaggcttga

DBGET integrated database retrieval system