KEGG   Arabidopsis thaliana (thale cress): AT4G24100Help
Entry
AT4G24100         CDS       T00041                                 

Definition
(RefSeq) Protein kinase superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like Haspin_kinase Seadorna_VP7 APH Kdo
Motif
Other DBs
NCBI-GeneID: 828510
NCBI-ProteinID: NP_001328321
MIPS: AT4G24100.1
TAIR: AT4G24100
Araport: AT4G24100
UniProt: A0A1P8B4B7
Position
4
AA seq 690 aa AA seqDB search
MVGGGGGSSGRGGGSGSGSSKQQRGFSMNPKDYKLMEEIGHGASAVVYRAIYLPTNEVVA
IKCLDLDRCNSNLDDIRRESQTMSLIDHPNVIKSFCSFSVDHSLWVVMPFMAQGSCLHLM
KTAYSDGFEESAICCVLKETLKALDYLHRQGHIHRDVKAGNILLDDNGEIKLGDFGVSAC
LFDNGDRQRARNTFVGTPCWMAPEVLQPGNGYNSKADIWSFGITALELAHGHAPFSKYPP
MKVLLMTIQNAPPGLDYDRDKKFSKSFKEMVAMCLVKDQTKRPTAEKLLKHSCFKHTKPP
EQTVKILFSDLPPLWTRVKSLQDKDAQQLALKRMATADEEAISQSEYQRGVSAWNFDVRD
LKTQASLLIDDDDLEESKEDEEILCAQFNKVNDREQVFDSLQLYENMNGKEKVSNTEVEE
PTCKEKFTFVTTTSSLERMSPNSEHDIPEAKVKPLRRQSQSGPLTSRTVLSHSASEKSHI
FERSESEPQTAPTVRRAPSFSGPLNLSTRASSNSLSAPIKYSGGFRDSLDDKSKANLVQK
GRFSVTSGNVDLAKDVPLSIVPRRSPQPTAQPQTIKEHSSHPTSSSPIMPQLQHLFQQNS
IQQDLIMNLLNSLQPVEATEGSQSGKLPPLPRSDSNGNVEPVASERERLLLSSISDLRAR
LDDLTEELDIEKSKYSQLQQKLKAFTGREH
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggtgggaggaggaggaggtagtagtggtcgtggtggtggtagtggtagtggtagtagt
aagcagcagagaggtttctctatgaatcctaaagactataagctaatggaagaaataggc
catggagctagcgctgttgtctatcgagcgatctatctccctactaatgaagtcgtcgcc
atcaagtgtttggatctcgatcgctgcaatagcaatctggatgatattaggagggaatct
cagactatgagtttgatagaccatcccaacgttataaagtcgttttgttcattctctgtc
gaccatagtctttgggttgttatgccattcatggctcaaggttcgtgtttgcatcttatg
aagactgcgtattcagacggatttgaagagtctgctatatgttgtgtattaaaagaaact
cttaaagctcttgattatcttcatagacaaggccatatccatcgggatgttaaggctgga
aacatacttcttgatgacaatggtgagattaagcttggcgattttggtgtctctgcttgc
ttgtttgataacggtgataggcaacgtgctagaaacacatttgttggtactccttgctgg
atggcaccggaagttttgcagccgggaaatggatacaattccaaggctgatatctggtca
tttggtataacagcacttgaattggcccatggtcatgcacctttctcaaaatatcctccc
atgaaggtgctcctaatgactattcaaaacgcacctcctggccttgattatgaccgtgat
aagaaattttctaagtcctttaaagaaatggttgcaatgtgtttggtgaaagatcaaaca
aaaaggccaactgctgaaaaactgctgaagcactcctgtttcaaacacacgaagcctcca
gagcaaactgtgaaaattttattttccgatttaccacctctttggacacgtgtaaaatct
cttcaggataaggatgctcaacagcttgcattaaagagaatggccactgctgacgaggaa
gctatatcacagagcgaataccaaagaggagtgagcgcttggaactttgacgtcagagac
ttgaaaacacaagcatctttgttaattgatgatgatgatctagaagagagtaaggaagat
gaagaaatattatgtgcacagtttaataaggtgaatgacagagagcaagtatttgatagt
ctgcaactatatgaaaacatgaacggaaaagaaaaggtttccaatactgaggtggaagaa
ccaacctgcaaagagaaattcactttcgttacaactacttcttctttagaacgaatgtca
ccaaattcagagcatgacattcccgaggccaaggttaagccattaagacgccaaagtcag
agtggaccacttacaagcaggactgtattaagccactcggcttcagagaaaagtcatatc
tttgaaagatccgagagtgaaccgcagacggcaccaacagtccgaagagcacccagcttt
agtggtcctttgaatctttcaacccgtgcttcttcaaacagtttgtctgctcccatcaaa
tactcaggaggattccgtgattctctggatgataagtcaaaggctaatctggttcagaaa
ggacgattttcagtaacatcaggaaatgtagatcttgcgaaggatgttccattaagtata
gtccctcgtcgatctccacagccaacagctcagcctcagacgatcaaggagcatagtagc
catcctacgtcttcctcacccatcatgcctcaacttcaacatctattccagcaaaactca
atacaacaggatcttattatgaatttactaaatagcttacaacccgtggaggcaacagaa
ggttctcaatctgggaagttaccacctttgcctcgctcagacagtaatggaaacgttgaa
cctgtggcttcagagagggagaggttacttcttagcagtatctccgacctccgtgctagg
ctggacgacttaacggaggaactcgatatagagaaatcaaaatacagccaactgcaacag
aaattgaaagcattcacgggtcgcgaacactaa

DBGET integrated database retrieval system