KEGG   Arabidopsis thaliana (thale cress): AT4G24120Help
Entry
AT4G24120         CDS       T00041                                 

Gene name
YSL1
Definition
(RefSeq) YELLOW STRIPE like 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: OPT
Motif
Other DBs
NCBI-GeneID: 828512
NCBI-ProteinID: NP_567694
MIPS: AT4G24120.1
TAIR: AT4G24120
Araport: AT4G24120
UniProt: Q6R3L0 A0A178V2Q5
Position
4
AA seq 673 aa AA seqDB search
MEIEQRRIMKREGEEEEDNNQLSLQEEEPDTEEEMSGRTIEPWTKQITVRGVFVSIVIGV
VFSVIAQKLNLTTGIVPNLNSSAALLAFVFVQTWTKILKKSGFVAKPFTRQENTMIQTSA
VACYGIAVGGGFASYLLGLNHKTYVLSGVNLEGNSPKSVKEPGLGWMTAYLFVVCFIGLF
VLIPLRKVMIVDLKLTYPSGLATAVLINGFHTQGDAQAKKQVRGFMKYFSFSFLWGFFQW
FFSGIEDCGFAQFPTFGLKAWKQTFFFDFSMTFVGAGMICSHLVNLSLLLGAILSYGLMW
PLLDKLKGSWFPDNLDEHNMKSIYGYKVFLSVALILGDGLYTFVKILFVTIANVNARLKN
KPNDLDDVGHKKQRKDLKEDENFLRDKIPMWFAVSGYLTFAAVSTVVVPLIFPQLKWYYV
IVAYIFAPSLAFCNAYGAGLTDINMAYNYGKIGLFVIAAVTGRENGVVAGLAGCGLIKSV
VSVSCILMQDFKTAHYTMTSPKAMFASQMIGTVVGCIVTPLSFFLFYKAFDIGNPNGEFK
APYALIYRNMAILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAM
AVPFLVGAYFAIDMCVGTLIVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALA
GVKPPICMKFLAS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagagcaaagaaggatcatgaagagagaaggagaagaagaagaagacaacaat
caactttcactgcaagaagaagaaccagatacagaggaagagatgtctgggaggacaatc
gaaccgtggacgaagcagataacggtgagaggagtgttcgtgagcatagtgatcggagtt
gtgttcagtgtgattgctcagaagctaaatctcacgacaggaattgttccaaatctcaac
agctctgcagctttacttgcttttgtctttgtccagacttggactaagattctcaagaaa
tcaggatttgttgcgaaaccattcacaagacaagagaacacaatgattcagacatctgct
gttgcttgttacggcatcgctgtcggaggtgggtttgcttcatatcttctggggttaaac
cataagacatatgtgttgtctggtgtgaacttggaaggtaactctccaaagagtgtgaaa
gaacctggccttggttggatgactgcttatctctttgttgtctgtttcatcggtcttttt
gtcctaatccctctccgaaaggttatgattgttgaccttaaattaacatatccgagtggt
ttagctactgcggttctcatcaatggcttccacacacaaggagatgcacaggccaagaaa
caagtgcgtggtttcatgaaatacttctcatttagtttcttgtggggtttcttccagtgg
tttttctctggtattgaagattgtggctttgctcaattcccaacctttggtttgaaagct
tggaaacaaacgttcttctttgatttcagcatgacatttgtgggagcaggaatgatttgt
tcacatttggttaacctttctttgcttttaggagctatcctctcttatggcttaatgtgg
cctcttcttgataaacttaagggctcttggttccctgataatctcgacgaacacaacatg
aagagcatttacggctacaaagtcttcttatccgtagctctaatcctcggcgacggtctt
tacactttcgttaagatcctctttgtgaccattgccaatgtcaacgcaagattgaagaac
aaacctaatgatctagatgacgtaggtcacaagaaacaacggaaagatctcaaggaagat
gagaatttcctcagagataaaatcccaatgtggttcgcagtttccggatatcttacattc
gctgcggtctcaaccgtcgtggttcctctgatatttcctcagctcaaatggtattacgtt
attgtagcttacattttcgcgccttctctggccttctgtaacgcttatggagctggactt
acagacattaacatggcttataactacggcaaaattggtctttttgtcatcgcggctgtg
acgggaagagagaacggagttgtagccggactcgccggttgtggactgatcaaatccgtt
gtttcggtttcttgtattttgatgcaagatttcaagacggctcattacacgatgacgtca
cctaaggctatgtttgctagccaaatgattggaacggtcgttggatgcatcgtgacgccg
ttaagtttctttttgttctacaaagcgttcgacattggaaaccctaacggagaattcaag
gctccttacgctttgatttacagaaatatggcgattcttggggtgcaaggcttctctgct
ctgcctcttcactgtctccaaatgtgttacgggtttttcgggtttgctgttttggtcaac
gtcgtcagagatcttactccggcgaagattggaagattcatgccacttccgacggcgatg
gctgttccgtttcttgtcggagcttatttcgcaatcgacatgtgtgttgggactttgatt
gtgtttgtttgggagaagatgaatcggaagaaagcagagtttatggttccggcggtggct
tcagggctaatctgtggcgaagggctttggactttacctgcggcggtgcttgccctcgcc
ggagtaaaacctccgatatgtatgaagttcttagcttcatag

DBGET integrated database retrieval system