KEGG   Arabidopsis thaliana (thale cress): AT4G24140Help
Entry
AT4G24140         CDS       T00041                                 

Definition
(RefSeq) alpha/beta-Hydrolases superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ser_hydrolase LIDHydrolase Abhydrolase_5
Motif
Other DBs
NCBI-GeneID: 828514
NCBI-ProteinID: NP_194145
MIPS: AT4G24140.1
TAIR: AT4G24140
Araport: AT4G24140
UniProt: O22977 A0A178UYY1
Position
4
AA seq 498 aa AA seqDB search
MAVMKIKGAATVAGTWLNEAVSFVVFCILDIVDSFLCLLYKAADYLFEAEWKPCYCLSDK
EPITTTRGKILLSHNNGESKILTLSPLQELGGRSKIELEDISETLYTRPSLISDISTISV
NELNKRFVKVTRSESECSGHNEKTKNKRRRSLTKSSLTVNFTVVEMLRGKIRPQNLNHDI
SRWSDCDCGFCTSWASTSDKNHSLFVKTQIPNGVTAKEDVLFIHGFISSSAFWTETVFPS
LSASSSTHRLFAVDLLGFGKSPKPADSLYTLREHVEMIEKSVLHKYNVKSFHIVAHSLGC
ILALSLAARHGGLIKSLTLLAPPYYPVPKGEKKPRQYVMKKVAPRKVWPPIALGASMACW
YEHISRTICLLICKHHRVWQFIAGVLTRNNRTVNFLIEGFMCHTHNAAWHTLHNIICGTG
SKLDTYLDIVRDKLKCNVTIFHGGDDELIPVECSYNVKQRIPRARVKVIEHKDHITMVVG
RQDEFARELQEIWKTSSC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgatgaagataaaaggagcagcgaccgtagcaggaacatggctgaacgaagcc
gttagcttcgtcgtgttctgtatcttagacatcgttgattcatttctttgtctcctctac
aaagcagctgattatctcttcgaagccgagtggaagccttgctattgcttgtcggacaag
gaacccatcaccacaactcgagggaagatccttttgtctcacaataatggcgagtccaag
atcctcactctttctccgcttcaagaactcggcggacgttccaagattgagctggaggat
atctccgagaccctttacacacgtccttctcttatttccgacatctcaaccatctccgtt
aacgagctcaataagcggttcgttaaggttactcggtcagagtctgagtgtagcggccat
aatgagaagaccaagaacaaaaggaggagatcattaacgaagtcaagcttgacggtgaac
ttcacggtcgttgagatgcttcggggaaagatcagaccgcagaatttgaaccacgatatc
tctcgatggtcggattgtgattgtgggttttgtacatcgtgggcctctacttctgacaaa
aaccattccctctttgtcaaaactcaaatcccaaatggggtaacagcgaaagaggatgtt
cttttcatacatggtttcatatcttcatcagcgttttggacggagacggtgtttccaagc
ctgtcagcctcctcctcgactcatagactcttcgccgtggatcttctaggattcggaaag
agtccaaagccagctgattcactctacacgttgagagaacacgtagagatgatcgagaaa
tctgtcttacacaaatacaatgtgaagtctttccacatcgtggctcactctttgggatgc
attttggcgcttagcctagccgctagacatggcggcttaatcaagtcgcttaccctcctt
gctccgccgtactatccagtaccgaagggagagaaaaagccgaggcagtacgtgatgaag
aaggtggcgccgaggaaggtttggccaccaatagctctcggagcgtcgatggcttgttgg
tacgaacacattagccgtaccatttgtctcctcatatgcaaacaccaccgtgtttggcaa
ttcatcgccggtgtcttgacccgaaacaacaggactgtaaactttttaattgaaggtttc
atgtgtcacacacacaacgcagcatggcatactctacataacattatatgtgggacagga
agcaaactcgatacgtatctagacatcgtacgagataaactaaagtgcaacgtgaccatc
ttccacggaggagacgacgaactcatccctgtcgagtgtagctacaacgttaaacagcga
attcctcgggcacgagttaaggttattgagcacaaagatcatatcactatggtcgttggc
agacaagatgagtttgccagagagctccaagagatttggaagacttcttcttgctaa

DBGET integrated database retrieval system