KEGG   Arabidopsis thaliana (thale cress): AT4G24290Help
Entry
AT4G24290         CDS       T00041                                 

Definition
(RefSeq) MAC/Perforin domain-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF
Motif
Other DBs
NCBI-GeneID: 828532
NCBI-ProteinID: NP_001328303
MIPS: AT4G24290.1
TAIR: AT4G24290
Araport: AT4G24290
UniProt: Q9STW5 A0A178V3R7
Position
4
AA seq 606 aa AA seqDB search
MALRLPASKAAEVAIGSIGCGYDLAIDLRLKYCKGGSKDSRLLDIKEGDDNCEIVLPGGI
SIPNVSKSIKCDKGERMRFRSDILPFQQMAEQFNQELSLAGKIPSGLFNAMFEFSSCWQK
DAAYTKNLAFDGVFISLYSVALDKSQVLLREHVKQAVPSTWDPAALARFIDIYGTHIIVS
VKMGGKDVIYAKQQHSSKLQPEDLQKRLKEVADKRFVEASVVHNTGSERVQASSKVETKE
QRLRFADTSSLGSYANKEDYVFMCKRRGGNDNRNLMHNEWLQTVQMEPDVISMSFIPITS
LLNGVPGSGFLSHAINLYLRYKPPIEELHQFLEFQLPRQWAPVFSELPLGPQRKQQSCAS
LQFSFFGPKLYVNTTPVDVGKRPITGMRLYLEGRRSNRLAIHLQHLSSLPKIYQLEDDLN
RSIRQESHDRRYYEKVNWKNYSHVCTEPVESDDDLSVVTGAQLHVESHGFKNVLFLRLCF
SRVVGATLVKNSEWDEAVGFAPKSGLISTLISHHFTAAQKPPPRPADVNINSAIYPGGPP
VPTQAPKLLKFVDTSEMTRGPQESPGYWVVSGARLLVEKGKISLKVKYSLFTPILGDEVI
EEAYEG
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcggctaccagcttctaaagcagctgaagttgcgattggatctattggctgt
ggttatgatctagctattgatttacggttgaagtattgcaaaggaggttccaaagattct
agattacttgacattaaagaaggtgatgataattgtgagattgttttacctggtggaatc
tccattcctaatgtttccaagtctatcaaatgcgataaaggggagcgtatgcggtttagg
tccgatattcttcctttccaacagatggcagagcagttcaaccaggaactatctttggct
gggaaaatcccgtcaggtctcttcaatgccatgtttgaattctcgagctgttggcagaaa
gacgcagcctacaccaaaaaccttgcttttgatggggttttcatctcattatactcggtg
gctttggacaaatctcaagtgttactccgtgagcatgttaagcaggctgttccatcaaca
tgggaccctgctgcattggcaaggtttatagatatttatgggacgcatataattgttagt
gttaagatgggaggaaaagatgtgatttatgcaaaacaacaacactcctcaaaacttcag
cctgaggatctgcagaaaaggttaaaagaggtggcagataagaggttcgtggaagctagc
gtagtgcataatacgggttcagaaagagtacaagcaagtagtaaggtggaaacaaaggag
caacgcctgagatttgcagataccagttctttgggctcttatgcaaataaggaggactat
gtcttcatgtgcaagaggcgaggtggaaacgataacagaaatctaatgcataatgaatgg
ctgcaaacagttcagatggagcctgatgttatctccatgtcttttattccaattacgtct
ttgcttaatggagttccaggaagtggattcttaagccatgccataaatctgtatctaaga
tataagccaccaattgaagagctgcatcagtttctcgagtttcagctaccaaggcagtgg
gcacccgtttttagtgaacttcctcttggtccgcaacgaaagcaacaaagttgtgcgtct
ctgcaattcagtttctttggacctaagctatacgtgaataccactccggttgatgttggt
aagaggccaatcactggcatgcggctctacctagagggtagaagaagcaaccgtttggca
attcatttgcaacacctttcctctcttcccaagatatatcagctcgaagacgatctaaat
agaagtatccggcaagagtctcatgaccgtcgatactatgagaaagtaaactggaagaac
tactctcacgtctgcacagagcctgtcgaatcagatgatgatctttctgtagtaacaggt
gcgcagcttcatgtagagagccacggattcaagaacgtgctcttcttgcgcctttgtttc
tctagagttgtgggagcaacactggtaaagaattctgaatgggatgaagcggtaggcttt
gctccaaaatcaggactcatctcaacgctaataagccatcacttcactgcagcacaaaaa
ccaccaccacgacctgcagacgtgaatataaattcggctatatatcctggtggaccacca
gtacccacgcaagctccaaaacttttgaaatttgtggatacaagtgagatgacaagaggg
ccgcaagaatcacccgggtattgggttgtatcgggtgcaagattattggtggagaaaggc
aaaatctcattgaaggtgaagtattctctatttactccaatattgggagatgaagtgatc
gaggaagcctatgaaggttaa

DBGET integrated database retrieval system