KEGG   Arabidopsis thaliana (thale cress): AT4G24670Help
Entry
AT4G24670         CDS       T00041                                 

Gene name
TAR2
Definition
(RefSeq) tryptophan aminotransferase related 2
  KO
K16903  L-tryptophan---pyruvate aminotransferase [EC:2.6.1.99]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00380  Tryptophan metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AT4G24670 (TAR2)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.99  L-tryptophan---pyruvate aminotransferase
     AT4G24670 (TAR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alliinase_C Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 828569
NCBI-ProteinID: NP_567706
MIPS: AT4G24670.1
TAIR: AT4G24670
Araport: AT4G24670
UniProt: Q94A02
Position
4
AA seq 440 aa AA seqDB search
MGQIPRFLSWRNMLVLSLAINFSLILKILKGDRERGDSWDRTAYVSIWPVVSTTASESSS
LSSASCNYSKIEEDDDRIINLKFGDPTVYERYWQENGEVTTMVIPGWQSLSYFSDENNLC
WFLEPELAKEIVRVHKVVGNAVTQDRFIVVGTGSTQLYQAALYALSPHDDSGPINVVSAT
PYYSTYPLITDCLKSGLYRWGGDAKTYKEDGPYIELVTSPNNPDGFLRESVVNSTEGILI
HDLAYYWPQYTPITSPADHDVMLFTASKSTGHAGIRIGWALVKDRETARKMIEYIELNTI
GVSKDSQLRVAKVLKVVSDSCGNVTGKSFFDHSYDAMYERWKLLKQAAKDTKRFSVPDFV
SQRCNFFGRVFEPQPAFAWFKCEEGIVDCEKFLREEKKILTKSGKYFGDELSNVRISMLD
RDTNFNIFLHRITSSFNSTL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggacagattccgaggtttctttcttggaggaatatgttggtcctctcgttggccatc
aacttcagcttgattctaaagattttgaagggtgatagagaacgaggagattcatgggac
agaacagcgtatgttagcatatggcccgtggtatccaccacggcttcagaatcttcttcg
ttgtcttcagcatcttgcaactatagcaagattgaagaagacgatgatagaattatcaat
ctcaaatttggtgatccaacggtgtatgagagatattggcaggaaaatggagaggtgaca
acaatggtgatacctggatggcaatctcttagctatttttcagatgaaaacaacctctgt
tggtttcttgagccagagcttgccaaagagattgtgagggtgcataaggttgttgggaat
gctgtaacgcaagaccgcttcattgttgttggcactggctcaacacaattgtatcaggct
gctctctatgctctctccccacatgatgactccggtcccattaatgtcgtgtcagccaca
ccctattatagtacatacccgttgattacagactgcctcaaatcaggtttatatcgatgg
ggtggagatgcaaagacgtacaaagaagatggtccatacattgaacttgttacatctcca
aacaaccctgatgggttcttgagagaatcagtagtgaacagtactgaaggtatattgatc
catgatttggcttactattggccacagtatacaccgataacatcaccagctgatcacgat
gttatgctcttcactgcttcaaagagcactggccatgcagggatacggattggatgggct
ttggtgaaagacagagagacggctaggaaaatgatagagtacattgaactcaacacgatt
ggggtttcaaaggactcacagcttagagtagccaaggttcttaaggttgtgtcagacagt
tgtgggaatgtaacgggcaaatctttctttgaccatagttatgatgctatgtatgagagg
tggaaactattgaaacaagcagcaaaggatactaaacgtttcagtgttcctgatttcgtc
tctcaacgttgcaatttctttggcagggtctttgagccacaaccagcatttgcatggttt
aagtgtgaagaagggatagtggattgtgagaagtttcttagagaggagaagaagattcta
actaaaagtggaaagtacttcggagatgagctaagtaatgtgaggataagcatgttggat
agagatactaactttaatattttccttcacaggattacatcttcctttaattcaactttg
taa

DBGET integrated database retrieval system