KEGG   Arabidopsis thaliana (thale cress): AT4G25170Help
Entry
AT4G25170         CDS       T00041                                 

Definition
(RefSeq) Uncharacterized conserved protein (UCP012943)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 828620
NCBI-ProteinID: NP_001154267
MIPS: AT4G25170.1
TAIR: AT4G25170
Araport: AT4G25170
UniProt: F4JSI0
Position
4
AA seq 359 aa AA seqDB search
MFGGGRGPMGGGGGMLRAAGRAMTRTGVANGGIQDPFASSSSSSTSSPAGNASVSHVQKQ
RSSSSGSNNLTYSAASGLLLNLPVAATSGWSGGGPFSFVNSGGYDDFEWVSEEEDDSLFG
SVPSVDEVQDAVSALQQSLKLFQLCLRDPTQLVFDASSYSQLVRDKYECYPENGGGNQSP
IATGMVHQVPSFGSDSDWMEPSMHLCHSRTLKPHAYDQVYNAFDLLRTEPSVQKMVVSLS
SDKAVWEAVMNNDVVREIRDLYNNGISQDEENSEDTPRENNAATDFIKWVFDNTMVKATE
VFVKITKVVTELFNCYNGDGVNNKGKDAKFNNWLEEKLTTSVLLSIIVMLVVMVSRACN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtggaggaagagggcctatgggtggcggcggaggtatgttacgcgccgccggt
cgtgcgatgacgaggaccggtgtagccaacggtggtattcaagatccctttgcttcttca
tcatcatcgtccacgtcgtctccggctggaaacgcctctgtttcgcatgtccagaaacag
agatcttcttcttctgggtcgaataatctgacgtattccgcggcttctgggttgttgttg
aatcttccggtggctgcaacctccggatggagcggcggcggtcctttttcctttgttaat
tctggaggttatgatgattttgagtgggtttctgaggaagaagatgattctctgtttggc
tctgttccttctgttgatgaagtccaagatgctgtttctgctctccagcaaagtttgaaa
ctctttcagctgtgtctccgtgaccccactcagttggttttcgatgctagttcatattcc
cagctggttagagacaaatacgagtgctatccggaaaatggtggtggaaaccagagccct
atagccacagggatggttcatcaagttccttcattcgggtcggattcggactggatggag
ccatcaatgcatttatgccattcaagaacgttaaagcctcatgcttatgatcaggtttac
aatgcttttgacctactacgaaccgaaccatctgtccagaaaatggtagtatcattgtcg
tctgacaaagcagtttgggaggcggtgatgaacaacgatgtggtgcgagagattagggac
ttgtacaacaatggcataagtcaagatgaggaaaattcagaagacacccctagggagaat
aacgcagcaacggatttcataaagtgggtatttgacaacacaatggttaaggccacggaa
gtgtttgtgaaaataacaaaggtcgtgaccgagctcttcaattgttacaatggtgatggt
gttaacaacaaggggaaagatgccaaattcaacaattggctcgaggaaaagctgaccact
tcggtcctgctatccatcatcgttatgctggtcgtgatggtatcccgagcctgcaactag

DBGET integrated database retrieval system