KEGG   Arabidopsis thaliana (thale cress): AT4G25270
Entry
AT4G25270         CDS       T00041                                 
Symbol
OTP70
Name
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PPR_2 PPR PPR_3 PPR_1 E_motif PPR_long
Other DBs
NCBI-GeneID: 828630
NCBI-ProteinID: NP_194257
TAIR: AT4G25270
UniProt: Q9SB36
Position
4:complement(12936931..12938910)
AA seq 527 aa
MVSIVVHKPSFSYPSVSSSSMKKKPRHHQQLKQHRQNQYNNNGFTSLSFTKPSPTPLLIE
KQSIHRTQLEALDSVITDLETSAQKGISLTEPEIFASLLETCYSLRAIDHGVRVHHLIPP
YLLRNNLGISSKLVRLYASCGYAEVAHEVFDRMSKRDSSPFAWNSLISGYAELGQYEDAM
ALYFQMAEDGVKPDRFTFPRVLKACGGIGSVQIGEAIHRDLVKEGFGYDVYVLNALVVMY
AKCGDIVKARNVFDMIPHKDYVSWNSMLTGYLHHGLLHEALDIFRLMVQNGIEPDKVAIS
SVLARVLSFKHGRQLHGWVIRRGMEWELSVANALIVLYSKRGQLGQACFIFDQMLERDTV
SWNAIISAHSKNSNGLKYFEQMHRANAKPDGITFVSVLSLCANTGMVEDGERLFSLMSKE
YGIDPKMEHYACMVNLYGRAGMMEEAYSMIVQEMGLEAGPTVWGALLYACYLHGNTDIGE
VAAQRLFELEPDNEHNFELLIRIYSKAKRAEDVERVRQMMVDRGLET
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggtgagtatcgttgtacacaaaccaagcttctcttatccatctgtatcgtcttcttca
atgaaaaagaaacccagacatcaccaacagttgaagcaacacagacaaaaccaatacaac
aacaatggattcacttccctctctttcaccaaaccatcccccactcctctcttgatcgaa
aaacaatccattcaccggacccaactcgaagctttagactctgtcattacagacctcgaa
acctccgctcaaaaaggcatctcattaaccgaaccagagatcttcgcttctcttctcgag
acctgctacagcttaagagctattgaccatggcgttagagttcatcaccttatacctccc
tatctcttgcggaacaacctggggatttcatcgaagcttgttagactctacgcctcttgt
ggctacgcggaagttgcacacgaagtgttcgatcgaatgtctaagagagactcatcgcct
tttgcttggaactctcttatctcaggctacgctgaattgggtcagtacgaagacgccatg
gctctttactttcagatggctgaagacggcgtgaaaccagaccggttcacatttccacgt
gttttaaaggcttgtggaggaattgggtctgttcaaattggagaagcgattcaccgtgat
ttggttaaggaaggttttggatacgatgtctatgtgctcaatgctcttgttgttatgtat
gcgaaatgcggcgacattgttaaagcgaggaatgtttttgacatgattcctcacaaagac
tatgtttcttggaactccatgttgactggttaccttcatcatggcttgttacacgaggca
ttggacatttttcgtctaatggttcagaatgggattgagcctgataaggttgctatctcc
agtgttctagctcgtgttttgtctttcaagcatggacgtcagctacatggatgggtaatt
aggcgaggcatggagtgggagttatcggttgcgaatgctttgattgttctatactccaaa
aggggacagttgggtcaagcctgcttcatatttgatcagatgctcgagagagataccgta
tcttggaatgctattatctctgctcattctaaaaattctaatggtttaaagtattttgag
cagatgcaccgtgctaatgctaaaccagatggtatcacgtttgtctcggttttatctctc
tgtgctaatacaggaatggtcgaagatggagagaggttgttctctttgatgtcaaaggaa
tacgggatagacccgaagatggaacactatgcgtgtatggtgaatctctacggaagagca
gggatgatggaagaggcttactcaatgattgttcaagagatggggcttgaggctggtcca
actgtttggggagctctgttatacgcttgttacctccatggaaatacagatataggagag
gttgctgctcaacgtcttttcgaattagaacctgataacgaacacaatttcgagctgttg
ataagaatttatagcaaagcaaaaagagcagaggatgttgagagagtaaggcagatgatg
gtggatagaggattggagacataa

DBGET integrated database retrieval system