KEGG   Arabidopsis thaliana (thale cress): AT4G26770
Entry
AT4G26770         CDS       T00041                                 

Definition
(RefSeq) Phosphatidate cytidylyltransferase family protein
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00564  Glycerophospholipid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT4G26770
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AT4G26770
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     AT4G26770
SSDB
Motif
Pfam: CTP_transf_1
Other DBs
NCBI-GeneID: 828784
NCBI-ProteinID: NP_194407
MIPS: AT4G26770.1
TAIR: AT4G26770
UniProt: Q1PE48 A0A178V2S1
Position
4
AA seq 471 aa
MAMEKDLSPNSPRIRKLRDTSYPTTPTSRMNTNNQRDNHYPNIPNSPRDYNYTPSSPTAR
IRHRRRSSENLAEVNRSNVSRVSNLLLGDKNKYRSMWIRTCSSLWMLGGVVFIIYMGHLY
IWAMVVVIQIFMAKELFFLRRRAHEERRLPGFWLLNWHFFFTAMLFVYGRIIQQQLVNTV
SSDRFIYKLVSGLIKYQMVICYFLYIAGLIWFILTLKNKMYKYQFGQYAWTHMILIVVFT
QSSFTVANIFEGIFWFLLPAALIAMNDVAAYFFGFYFGKTPLIKLSPKKTWEGFIGASVA
TIISAFIFANVLGQFQWLTCPRKDLSTGWLHCDPGPLFRPEYYPFPSWITPFSPWKGIST
LPVQWHAFSLGLFASIMAPFGGFFASGFKRAFKIKDFGDSIPGHGGFTDRMDCQMVMAVF
AYIYIQSFIVNRDYSVEMILDQISRSLGHEEQKMLYEKLGDILQHKLQGRF
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggcaatggagaaagatctcagtccaaattctccacggattagaaagctaagggatact
agttaccctactacaccaacgtctcgaatgaatactaataaccagagagataaccattat
cccaacattcctaattcaccaagggattacaattatactcctagctctccaacagctcgc
attcgacaccgcaggcgatcaagcgagaatttagctgaggtgaacagaagcaatgtaagc
agagtaagcaatttgttacttggtgataagaacaagtacagatcaatgtggataaggaca
tgctcatctctctggatgctcggtggagttgtgtttataatctacatgggtcatctctac
atttgggctatggttgtggttatacagatattcatggccaaagagctcttctttcttcgc
agaagagctcatgaagaacgtcgcttacccggtttctggctcttgaattggcacttcttc
ttcacggctatgttgtttgtctatggacgcatcattcaacagcagctagtcaacacggtt
tcttcagatagattcatatacaagcttgtgagtggtcttatcaagtaccagatggttatt
tgctacttcttgtacatcgcaggtctcatatggtttatccttacattgaagaataagatg
tataagtatcagtttgggcaatacgcttggacacatatgatccttatcgttgtctttact
caatcttctttcaccgtcgccaatatttttgaagggatcttctggtttcttctaccagca
gcactgattgctatgaacgatgtagcagcttacttcttcggtttctatttcgggaaaact
ccgctcatcaagttgtctccaaagaaaacatgggaaggtttcatcggagcatcagttgca
actataatctctgcatttatttttgctaatgtcttaggccagttccaatggcttacatgt
ccaaggaaggatttatcaactggttggcttcattgtgatccaggccctctcttcaggcca
gagtattacccatttccctcttggattactccattttctccatggaaagggatctcgacc
ctgcctgtccaatggcatgctttttctctcggtctattcgcatccattatggcgcctttt
ggtggcttcttcgcaagcggtttcaaaagagctttcaagatcaaggatttcggagacagc
ataccaggacatggaggatttactgacagaatggattgccaaatggttatggcggttttc
gcatacatctacatccaatctttcattgttaatcgggactacagtgtcgagatgatccta
gaccagatatcgaggagcctgggacacgaggagcagaaaatgctttatgaaaagctcgga
gacattcttcaacataagttgcaagggaggttttaa

DBGET integrated database retrieval system