KEGG   Arabidopsis thaliana (thale cress): AT4G26910Help
Entry
AT4G26910         CDS       T00041                                 

Definition
(RefSeq) Dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00020  Citrate cycle (TCA cycle)
ath00310  Lysine degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT4G26910
  Amino acid metabolism
   00310 Lysine degradation
    AT4G26910
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AT4G26910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H RnfC_N DUF3729
Motif
Other DBs
NCBI-GeneID: 828798
NCBI-ProteinID: NP_567761
MIPS: AT4G26910.1
TAIR: AT4G26910
Araport: AT4G26910
UniProt: Q8H107
Position
4
AA seq 464 aa AA seqDB search
MMMRAVIRRAASNGSSPSLFAKSLQSSRVAASSPSLLSGSETGAYLHRGNHAHSFHNLAL
PAGNSGISRSASLVSSTLQRWVRPFSAETGDTVEAVVPHMGESITDGTLATFLKKPGERV
QADEAIAQIETDKVTIDIASPASGVIQEFLVNEGDTVEPGTKVAIISKSEDTASQVTPSQ
KIPETTDTKPSPPAEDKQKPRVESAPVAEKPKAPSSPPPPKQSAKEPQLPPKERERRVPM
TRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFYEKHGVKLGLMSGFIKA
AVSALQHQPVVNAVIDGDDIIYRDYVDISIAVGTSKGLVVPVIRGADKMNFAEIEKTINS
LAKKANEGTISIDEMAGGSFTVSNGGVYGSLISTPIINPPQSAILGMHSIVSRPMVVGGS
VVPRPMMYVALTYDHRLIDGREAVYFLRRVKDVVEDPQRLLLDI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcgtgctgttataaggagagctgccagtaatggctcttctccttcgttattc
gcaaaatcactgcagtcttctcgtgttgctgcatcttcccctagcttgctatcaggttca
gaaacaggggcatatctgcatcgtggaaatcatgctcatagctttcataaccttgctttg
ccagcagggaactcgggcatctcgaggtcggcgagtttagtttcttcaaccctgcaaaga
tgggtcaggcctttttcagctgaaactggagataccgtggaagcagttgtgcctcatatg
ggggaatcaattactgatggcaccttggccacctttctgaagaaacctggtgagagagtc
caggctgatgaggctattgcacaaattgaaactgataaggtgacaatagatattgctagc
ccagcaagtggtgtaatccaagagtttctagtcaacgaaggagatactgtagaaccagga
accaaggtcgctattatatcaaagtctgaggatactgcatctcaggttaccccctctcag
aagataccagagacaactgataccaaaccttctcctcctgctgaagataagcagaagccc
agagtggaaagtgctcctgtagcagagaaacccaaagcaccatcctcaccacctccaccc
aaacagtctgctaaagaaccgcagcttcctcctaaggaaagagaaagacgggttccgatg
acaagacttcggaaacgagttgcaacaagattgaaagactctcaaaatactttcgcgttg
ctgacaactttcaatgaagttgatatgacaaatttgatgaagctccgatcccaatacaag
gatgcattttatgaaaagcatggagtgaagttggggcttatgtctggatttattaaagct
gctgttagcgcccttcagcatcaaccagttgtaaatgcagttattgacggggatgatatc
atatacagagactatgtggatatcagtatcgctgttggtacctctaagggacttgtagta
ccagtcataagaggtgctgataaaatgaactttgccgagatagagaagacgataaactca
cttgccaagaaggcaaatgaaggaaccatatccatagatgagatggctggcggatcattc
accgtttcaaatggcggtgtctatggaagtctcataagcactccgatcattaatcctcct
cagtctgccatactcggcatgcactcgattgtgtcacgtccaatggtagtaggaggaagc
gtagtgcctagaccaatgatgtatgtcgcacttacgtatgatcacaggctgattgatggt
agagaggctgtgtacttcctgcgccgtgtcaaggatgttgtggaggatccacaaaggctt
cttcttgacatataa

DBGET integrated database retrieval system