KEGG   Arabidopsis thaliana (thale cress): AT4G27820Help
Entry
AT4G27820         CDS       T00041                                 

Gene name
BGLU9
Definition
(RefSeq) beta glucosidase 9
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00460  Cyanoamino acid metabolism
ath00500  Starch and sucrose metabolism
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT4G27820 (BGLU9)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT4G27820 (BGLU9)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT4G27820 (BGLU9)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT4G27820 (BGLU9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 828895
NCBI-ProteinID: NP_194511
MIPS: AT4G27820.1
TAIR: AT4G27820
Araport: AT4G27820
UniProt: Q9STP4
Position
4
AA seq 506 aa AA seqDB search
MKHFSLLFIFLVILLATSYSDAFTRNSFPKDFLFGAATSAYQWEGAVAEDGRTPSVWDTF
SNSYDTGNGDVTSDGYHKYKEDVKLMATMGLESFRFSISWSRLIPNGRGLINPKGLLFYN
NLIKDLKSHGIEPHVTLYHYDLPQSLEDEYGGWINRKIIEDFTAYADVCFREFGEDVKLW
TTINEATIFAIGSYDQGTAPPGHCSPNKFVNCSTGNSSTEPYIAGHNILLAHASASKLYK
LKYKSKQKGSIGLSIFAFGLSPYTNSKDDEIATQRAKTFLYGWMLKPLVFGDYPDEMKKT
VGSRLPVFSEEESEQVKGSSDFIGIIHYTTFYVTNHQPSASLFPSMGEGFFKDMGVYIIP
TGNSSFLVWEATPWGLEGILEYIKQSYNNPPVYILENGMPMVRDSTLQDTQRIEYIQAYI
DAVLNAMKNGSDTRGYFVWSMVDVYEILSGYTTSFGMYHVNFSDPGRKRTPKLSASWYTG
FLNGTIDVASQDTIQLWSNFSVSSSL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatttctctctacttttcatttttctggtcatcctcttggcaacaagctacagt
gatgcctttaccagaaacagttttccaaaggatttcctcttcggagccgccacttctgct
tatcagtgggaaggagctgttgctgaagatggaagaactcctagtgtctgggatactttc
tccaactcttacgatacaggtaatggagatgtaacatctgatgggtatcacaaatacaag
gaagatgttaagctgatggcaacaatgggcttagaatcattcagattctctatctcctgg
tcaagacttatacctaatggaagaggactcattaatccaaaaggactattgttttacaac
aatctcatcaaagacctaaaaagccatggaatcgaaccacatgttacactttaccactat
gatcttcctcagtctcttgaagatgagtacggcggatggatcaaccgcaaaatcatagaa
gacttcactgcttatgcagatgtatgcttcagagagtttggggaggatgtgaagttatgg
actacaataaacgaagctacaattttcgccattggttcttatgaccaaggaaccgcgccg
cctggacattgttctcctaataaattcgtcaattgttctactggaaattcttctacagaa
ccatatattgcaggccataacatattgctagctcatgcctctgcttcaaagttgtataaa
ctaaagtacaagagtaagcagaaaggatccatagggcttagtatatttgcattcgggtta
tctccatatacaaactccaaggatgatgaaatcgcaactcaaagagctaaaactttctta
tatggctggatgttgaagcctttggtatttggagactatccggatgaaatgaagaaaact
gtgggatcgagattaccagttttctcagaggaagagtcagagcaagttaaaggatcatct
gactttataggaattattcattacacaacattctatgtcacaaaccaccaaccttcagct
tctctctttcccagcatgggtgaaggcttctttaaagacatgggagtatatataattccc
actgggaattcttcatttcttgtgtgggaggctactccatggggtcttgaaggtattctt
gagtatataaagcagagctataacaatcctccagtctatattcttgaaaatggtatgccg
atggtacgcgattcgacactacaagacacacaaagaattgaatacattcaagcttacatt
gacgctgtactcaacgcaatgaagaatggatcggacacgagaggttactttgtatggtcg
atggttgatgtgtatgagatattgagtggatatacgaccagcttcggaatgtaccatgtg
aatttcagcgatcctggtcgcaagaggactccaaagctctctgcttcttggtacactggt
ttccttaatggtacaattgatgttgcttctcaagatactattcagttgtggagcaacttc
tctgtctcttcttcattgtaa

DBGET integrated database retrieval system