KEGG   Arabidopsis thaliana (thale cress): AT4G28700
Entry
AT4G28700         CDS       T00041                                 

Symbol
AMT1;4
Name
(RefSeq) ammonium transporter 1;4
  KO
K03320  ammonium transporter, Amt family
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT4G28700 (AMT1;4)
Transporters [BR:ath02000]
 Other transporters
  Pores ion channels [TC:1]
   AT4G28700 (AMT1;4)
SSDB
Motif
Pfam: Ammonium_transp PhoR
Other DBs
NCBI-GeneID: 828988
NCBI-ProteinID: NP_194599
TAIR: AT4G28700
UniProt: Q9SVT8 A0A178UUD8
Position
4:14161681..14163195
AA seq 504 aa
MASALSCSASDLIPLLSGGANATAAAAAAEYICGRFDTVAGKFTDAAYAIDNTYLLFSAY
LVFAMQLGFAMLCAGSVRAKNTMNIMLTNVIDAAAGGLFYYLFGFAFAFGSPSNGFIGKH
FFGMYDFPQPTFDYPYFLYQWTFAIAAAGITSGSIAERTQFVAYLIYSSFLTGLVYPIVS
HWFWSSDGWASPARSENLLFQSGVIDFAGSGVVHMVGGIAGLWGALIEGPRIGRFGVGGK
PVTLRGHSATLVVLGTFLLWFGWYGFNPGSFATIFKAYGETPGSSFYGQWSAVGRTAVTT
TLAGCTAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITSGCSVVEPWAALVCGFVAAWV
LMGCNRLAEKLQFDDPLEAAQLHGGCGAWGIIFTGLFAEKRYIAEIFGGDPNRPFGLLMG
GGGRLLAAHVVQILVITGWVSVTMGTLFFILHKLKLLRIPAEDEIAGVDPTSHGGLAYMY
TEDEIRNGIMVRRVGGDNDPNVGV
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcgtcggctctctcttgctctgcctctgatctgattccattactatcaggtggagcc
aacgccaccgcagcagcagccgccgctgaatacatctgcgggagattcgacacagtcgcc
gggaaattcactgatgcggcttacgcaatcgacaacacttaccttctcttctctgcttac
ctcgttttcgcgatgcagctcggtttcgccatgctctgtgccggatccgtacgtgcaaaa
aacacgatgaacattatgctcacgaacgtcatcgacgctgcagccggaggtctcttctat
tatctcttcggtttcgcttttgcttttggatctccttctaatggattcatcggaaaacat
ttctttggaatgtatgattttcctcaacctacgtttgattatccttattttctatatcaa
tggactttcgctatcgccgccgctggaatcacgagtggttcgatagcggagaggactcag
ttcgttgcgtatttgatctattcttctttcttgacgggtcttgtttacccgattgtgtcg
cattggttttggtcttctgatggttgggcgtctccggctagatctgagaaccttctgttt
caatcaggtgtgattgatttcgctggctctggtgttgttcatatggttggtggtattgct
ggtttatggggagctttaattgaaggacctaggattggtcggtttggagttgggggtaaa
ccggttacgttgcgtggtcatagtgctacgttggttgttcttggaacgtttttgttatgg
ttcggatggtacgggtttaacccgggctcgtttgcaactatttttaaggcgtatggggag
actccagggagctcgttttacggacaatggagcgcagttgggagaaccgcggtaacaact
acgttagctggttgcacggcggcgttaacgactctgtttgggaaaagacttattgatggg
tattggaatgtaactgatgtttgcaatggtttgttaggcgggtttgcggctataactagc
ggatgttcggttgtggaaccgtgggctgcgcttgtatgtgggtttgtagccgcatgggtg
ctgatgggatgcaatagactagcggaaaagctccaatttgatgatccgttggaagcggct
cagcttcacggtggttgtggtgcgtgggggattattttcaccgggttgttcgcggagaaa
agatacattgccgagatctttggaggcgacccgaataggcctttcggattgctaatggga
ggaggaggtaggttgcttgcggcgcacgtcgttcagattttggtgattacgggttgggtt
agtgtgacaatggggactctgttttttattttgcataagctgaaactgttgaggataccg
gcggaggatgagatagctggggtggatccgacgagtcacggagggttggcttatatgtac
acagaagatgagattaggaatgggatcatggttaggagagtgggtggtgataatgatccc
aatgtaggtgtttga

DBGET integrated database retrieval system