KEGG   Arabidopsis thaliana (thale cress): AT4G29190
Entry
AT4G29190         CDS       T00041                                 

Gene name
OZF2
Definition
(RefSeq) Zinc finger C-x8-C-x5-C-x3-H type family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Other DBs
NCBI-GeneID: 829040
NCBI-ProteinID: NP_194648
MIPS: AT4G29190.1
TAIR: AT4G29190
UniProt: Q9M0G2
Position
4
AA seq 356 aa
MMIGETRRTYPTVEIPPWPVLEELTTSEFFSPVMNSPDCSMLEALAGLQRYLPSNEPDPE
SYPDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHY
SGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQPCKDGGNCLRKICFFAHSPDQL
RFLHTRSPDRVDSFDVSSPIRARAFQLSISPVSGSPPMSPRADSESSPMTQSLSRSLGSC
SINDVVPSFRNLQFNSVKSFPRNNPLFGFGSPRGSILGPGFQSLPTTPTRPGNLDIWEYG
LEEEPVMERVVESGRELREKMREKLHKENCMDRVAQDPDQNLGEAPDVGWVSDLLM
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgatgatcggagaaactcgcaggacttatcccactgttgaaatacctccatggccggta
cttgaagagcttacaacgtcggagtttttttctccggtgatgaatagtccagattgtagc
atgcttgaagctttggcggggttgcagcgttatttgccgtctaacgaaccggatccggag
tcatacccggatctattgggtccggattcaccaatcgatgcttactcatgcgaccatttc
cgtatgtacgatttcaaagtcaggaggtgtgctcgtggccggagtcatgattggacggag
tgtccgtacgctcatcccggagaaaaagctcgccggagagatccgaggaagtaccattac
tctggtacggcttgtcctgattttcgtaaaggtggctgcaagaaaggtgactcttgtgag
tttgctcatggtgttttcgagtgttggcttcatccagctcgttaccgtactcagccgtgt
aaagacggtggtaactgtctccggaaaatttgtttctttgctcattcaccggatcagctt
aggtttttacatactcggagccctgacagagttgattcttttgacgtttcgtctccgatt
cgtgctagagcatttcagctgtcgatttctccggtttctggttcgccaccgatgagtcca
agagctgactcggagtcttctccgatgactcagtcactgagtcgatctctcgggtcttgt
tcgataaacgacgtcgttccttcgtttaggaatttacagtttaattcggtaaaatcattt
cctcgtaacaatcctttattcggattcgggtcgccccgtggatcgatcttgggtcctggg
tttcagtctctgcctacaacaccgacccgaccagggaatctggatatttgggagtatggt
ttggaggaagaacccgtaatggagcgtgtcgttgagtcgggtcgtgagctacgagaaaag
atgcgcgagaaactgcacaaggagaattgcatggatcgagttgcccaggatccggatcag
aatttgggtgaggctcctgatgtcgggtgggtatctgacctgctcatgtaa

DBGET integrated database retrieval system