KEGG   Arabidopsis thaliana (thale cress): AT4G29380Help
Entry
AT4G29380         CDS       T00041                                 

Gene name
VPS15
Definition
(RefSeq) protein kinase family protein / WD-40 repeat family protein
  KO
K08333  phosphoinositide-3-kinase, regulatory subunit 4 [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT4G29380 (VPS15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT4G29380 (VPS15)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G29380 (VPS15)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT4G29380 (VPS15)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: Other
  VPS15 family
   AT4G29380 (VPS15)
Membrane trafficking [BR:ath04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    AT4G29380 (VPS15)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    AT4G29380 (VPS15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase WD40 HEAT Pkinase_Tyr Adaptin_N Vac14_Fab1_bd Cnd1 HEAT_EZ Tti2
Motif
Other DBs
NCBI-GeneID: 829059
NCBI-ProteinID: NP_194667
MIPS: AT4G29380.1
TAIR: AT4G29380
Araport: AT4G29380
UniProt: Q9M0E5
Position
4
AA seq 1494 aa AA seqDB search
MGNKIARTTQVSATEYYLHDLPSSYNLVLKEVLGRGRFLKSIQCKHDEGLVVVKVYFKRG
DSIDLREYERRLVKIKDVFLSLEHPHVWPFQFWQETDKAAYLVRQYFYSNLHDRLSTRPF
LSLVEKKWLAFQLLLAVKQCHEKDICHGDIKCENVLLTSWNWLYLADFASFKPTYIPYDD
PSDFSFFFDTRGQRLCYLAPERFYEHGGETQVAQDAPLKPSMDIFAVGCVIAELFLEGQP
LFELAQLLAYRRGQHDPSQHLEKIPDPGIRKMILHMIQLEPEARLSAEDYLQNYVGVVFP
NYFSPFLHTLYCCWNPLPSDMRVATCQGIFQEILKKMMENKSGDEIGVDSPVTSNPMNAS
TVQETFANHKLNSSKDLIRNTVNSKDEIFYSISDALKKNRHPFLKKITMDDLGTLMSLYD
SRSDTYGTPFLPVEGNMRCEGMVLIASMLCSCIRNIKLPHLRREAILLLRSCSLYIDDDD
RLQRVLPYVVALLSDPTAIVRCAAMETLCDILPLVRDFPPSDAKIFPEYIFPMLSMLPED
TEESVRICYASNIAKLALTAYGFLIHSFQLSDVGVLNELNSQQISTTPASETPSHLQKAN
GNAQLQQLRKTIAEVVQELVMGPKQTPNVRRALLQDIGELCFFFGQRQSNDFLLPILPAF
LNDRDEQLRSVFFEKIVYVCFFVGQRSVEEYLLPYIDQALSDQTEAVIVNALECLSTLCK
SSFLRKRALLQMIECVYPLLCYPSQWVRRAVVTFIAASSECLGAVDSYAFIAPVIRSYLS
RLPASIASEEGLLSCLKPPVTREVVYRIFEKTRNPEFMAKQRKMWYSSSPQSKDWESVDL
FDKDAGELNSVECRAEQKQSVEGKKQIKSASKQPEVQGKYAEKDAKLRIPRNPRPNASNT
VELRDPVYPEKLQFSGFMAPYVSGANSFIEPENIPLYSFSMDKRAATNPPVASESSLQMN
SLGMGSLSVPWMDSMSKSFNLASSVPVPKLISGSFHVGTNPKQFYRVVHEPESRENDQIS
SAISKFQDLGVSSSSKSASVTSEDASSPADLVGEPSLSRTSVPDSGWKPRGVLVAHLQEH
RSAVNDIATSSDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRGMCTTMLRN
STQVVVGASDGVIHMFSIDHISRGLGNVVEKYSGIVDIKKKDVKEGALVSLLNYTADSLS
GPMVMYSTQNCGIHLWDTRSDLDAWTLKANPEEGYVSSLVTSPCGNWFVSGSSRGVLTLW
DLRFRVPVNSWQYPIICPIEKMCLCFLPPSVSVSTTMKPLIYVAAGCNEVSLWNAEGGSC
HQVLRVANYENETDVSEFQWKLPSNKVNPKPNHRQNMSSKYRIEELNEPPPRLPGIRSLL
PLPGGDLLTGGTDLKIRRWDYSSPERSYCICGPSLKGVGNDDFYELKTNTGVQFVQETKR
RPLATKLTAKAVLAAAATDTAGCHRDSVQSLASVKLNQRLLISSSRDGAIKVWK
NT seq 4485 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaaaatcgctcgtacgacacaagtctcggcgacggagtactatctccacgac
ttgccgtcttcatacaatctggtcttaaaagaggttttaggtcgaggaagattcctaaag
tcgattcaatgtaagcacgatgaaggattggttgttgttaaggtttacttcaagcgtggt
gactcgatcgatctcagagagtatgagcgtcgtctcgttaagatcaaagatgtgtttttg
tctctagaacatcctcacgtttggccttttcagttttggcaagagactgataaagcagcg
tatctagtgaggcaatacttttacagtaatctacatgatcgcttgagtacgaggcctttc
ctcagtcttgtagagaagaagtggttggcgtttcagttgcttcttgctgtgaagcaatgt
catgagaaggatatatgtcatggtgatatcaagtgcgagaacgtattgttgacttcctgg
aactggctttaccttgctgattttgcatccttcaaacctacatacattccttatgatgat
ccttcagacttctcgttcttctttgacacaaggggacaaagactttgttatctggctcca
gagagattctatgagcatggaggtgagacacaagtagcacaagatgctccattaaagccc
tccatggatatatttgctgtggggtgtgtgatagccgaactttttcttgagggtcagcca
ctatttgaactggcgcagcttctcgcttatcgtagagggcaacatgatcctagccaacac
cttgaaaagattcctgatccgggaattcgcaagatgattcttcatatgattcagttagaa
cccgaagcacgcctatctgctgaagactacctgcaaaattatgtgggagttgttttccca
aactacttctcaccatttctgcacactttatattgttgttggaatccacttccttcagac
atgagggtagcaacttgccaggggatatttcaagaaatacttaaaaagatgatggaaaat
aagtcaggtgatgagatcggcgttgattctcctgtaacttcaaatccaatgaacgcaagc
acagtacaggaaacttttgcaaatcacaaattgaactcatctaaggatttgataaggaat
actgtgaactctaaggatgagatcttttactctatttctgatgcactcaagaaaaatcgc
catcctttcttgaaaaagataacaatggacgatttgggtacactgatgtctctctatgat
agccgttctgacacttatggcacgccttttctaccggtagagggtaacatgagatgtgag
ggaatggttctgattgcatctatgctctgttcttgtatccgcaatatcaagttgcctcat
ttgaggagggaagctatacttctattgagatcttgctctttgtatattgatgatgatgat
cgcttacagcgtgtacttccatacgtcgttgccttgctttctgatccaacagcaatcgtg
cggtgcgctgccatggaaactttgtgtgacattctgccgcttgtccgagattttcctcct
agtgatgcaaagattttcccagagtacatatttccgatgctctccatgcttcctgaagat
acggaagagagtgtgaggatatgctatgccagcaatattgcaaaactcgctcttactgct
tatggattcttgatacattctttccagttgagcgatgtaggggttcttaatgaattgaat
tcccagcagatctccactacacctgctagtgagacccctagtcatttgcaaaaggcaaat
ggcaatgcgcagcttcaacagcttagaaaaactatagctgaagttgttcaagagcttgtt
atgggtccaaaacaaactccaaatgttagaagagcactccttcaggacataggggagctc
tgctttttctttggtcagaggcagagtaatgactttctactaccgatcctccctgccttt
ctaaacgacagagatgagcagctaagatctgtattctttgagaagattgtttatgtatgc
ttttttgttggccagagaagtgtggaggagtatctattgccttatatcgatcaagctttg
agtgatcagacggaggctgttattgtcaatgcattggagtgcttatccacattatgcaag
agtagtttcttgcggaagagagctctcctccaaatgatagagtgtgtttatcctttgttg
tgctatccatctcaatgggtaaggagggcagttgtcactttcattgccgcaagtagtgaa
tgcttaggtgcagtcgactcttatgcttttattgccccagtaatacgctcttatcttagt
agactgcctgcgtcaattgcttctgaggaaggtctactttcatgtttgaagccccctgtc
acaagggaggtagtttatcgtatctttgaaaaaaccaggaacccagaattcatggcgaaa
cagcgaaagatgtggtatagttcttcacctcagtccaaagattgggaatctgttgatttg
tttgacaaagatgctggggagttgaattcagtagaatgcagggccgaacagaagcaaagt
gtggaaggaaaaaaacagattaagagtgcatcaaagcaaccagaagttcaaggaaagtat
gcagaaaaggatgctaaattaagaatcccgagaaacccaagacctaatgcttctaacact
gttgagctacgtgatcccgtgtatccagagaagttacagttctctgggtttatggcacca
tatgtatctggtgcgaatagctttattgaaccagagaacatacctctctattcgtttagc
atggacaaacgagcagctacaaatcctcctgtggcttctgagtcttcattgcagatgaac
tctctgggaatgggttcattgtctgtgccatggatggattccatgagtaaatcatttaac
ttggctagttcggtcccagtgcctaagctgatttctgggtcattccatgtcggtaccaat
cctaaacaattttacagagtggtacatgagccagaaagcagagaaaatgatcaaatctcc
tcagccatcagtaaatttcaagacctcggagtatcaagctcctcaaaaagtgcttctgta
acttcagaagatgcttcttctccagcggatcttgtaggagagccatctctgtcaaggaca
tcggttccggattcagggtggaagcctcgtggagtattagttgctcatctacaagagcat
cgctctgcggtcaatgacattgccacttcaagcgatcatagcttttttgttagtgcatca
gatgattccacagtgaaggtgtgggactctagaaaactggaaaaggacatctcttttagg
tcaaggctaacatatcatctcgagggaagcagagggatgtgcacaacaatgcttcggaat
tcaacgcaagttgtagttggagcctctgatggtgtgatacatatgttttcaattgaccat
atctccagaggcttggggaacgtagtggagaagtattcaggcattgttgatattaaaaag
aaagatgttaaagaaggcgctctagtttctctcttgaattatactgctgatagcctttct
ggtccgatggtaatgtatagtacccaaaactgcggaatccacctttgggatacaaggtca
gatttagatgcatggacactgaaagcaaatcctgaagaaggatatgtgtcttcattggtt
acaagtccttgtgggaattggtttgtctctgggtcttcaaggggagtgcttactctttgg
gatttgagatttcgtgttcctgtaaattcgtggcaataccccatcatatgtcccatagag
aagatgtgcctctgctttcttcctccaagcgtctcagtgtccaccactatgaaaccttta
atttatgttgctgccggttgcaacgaagtttcactctggaatgcagagggaggtagctgt
caccaggtattgagagtagccaattatgaaaatgagacggatgtttccgagtttcaatgg
aagttaccaagcaataaggtaaatccgaagccgaatcatcgtcagaacatgagctccaag
tacagaatcgaagagttgaacgagcctcctcctcgtcttcctggtatccgctctttgctc
cctttacctggaggtgacttgttaacaggtggtactgacttgaagattcggcgttgggat
tactccagccctgagagaagttattgtatatgcggtccgagtttgaaaggagtcggaaat
gatgatttctatgaactaaaaaccaacacgggcgtgcaatttgttcaggagacaaagaga
cggcctctggctactaaactgacggcaaaggcggtacttgcggctgctgcgacagacaca
gcgggttgtcatcgtgactcagttcagtctctggcatctgtgaagctgaaccagagactg
ttgatatcaagcagcagagatggagccataaaggtctggaagtaa

DBGET integrated database retrieval system