KEGG   Arabidopsis thaliana (thale cress): AT4G29840Help
Entry
AT4G29840         CDS       T00041                                 

Gene name
MTO2
Definition
(RefSeq) Pyridoxal-5'-phosphate-dependent enzyme family protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00750  Vitamin B6 metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01230  Biosynthesis of amino acids
Module
ath_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT4G29840 (MTO2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AT4G29840 (MTO2)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AT4G29840 (MTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP OKR_DC_1_N
Motif
Other DBs
NCBI-GeneID: 829106
NCBI-ProteinID: NP_194713
MIPS: AT4G29840.1
TAIR: AT4G29840
Araport: AT4G29840
UniProt: Q9S7B5
Structure
PDB: 

Position
4
AA seq 526 aa AA seqDB search
MASSCLFNASVSSLNPKQDPIRRHRSTSLLRHRPVVISCTADGNNIKAPIETAVKPPHRT
EDNIRDEARRNRSNAVNPFSAKYVPFNAAPGSTESYSLDEIVYRSRSGGLLDVEHDMEAL
KRFDGAYWRDLFDSRVGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFG
KQFLGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMKRPVVGVGCASTGDTSAALS
AYCASAGIPSIVFLPANKISMAQLVQPIANGAFVLSIDTDFDGCMKLIREITAELPIYLA
NSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDRIP
RMVCAQAANANPLYLHYKSGWKDFKPMTASTTFASAIQIGDPVSIDRAVYALKKCNGIVE
EATEEELMDAMAQADSTGMFICPHTGVALTALFKLRNQGVIAPTDRTVVVSTAHGLKFTQ
SKIDYHSNAIPDMACRFSNPPVDVKADFGAVMDVLKSYLGSNTLTS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgtcttgtctcttcaatgcctctgtatcgtccttaaaccctaaacaagacccc
atccgccgccaccggtcaacctctctcctccgccaccgccccgtcgtcatctcctgtacc
gccgatggcaacaacatcaaagccccgatcgagacagcggtcaagcctcctcaccgtacc
gaggataacattcgagatgaggctcgtcgtaatcgttccaacgccgtgaatccattttca
gctaaatacgttccgtttaatgcagctcctggatccacggagtcttactctctcgacgag
atcgtgtaccgtagccgctccggtggtttgcttgatgtcgaacacgatatggaggctttg
aagcgattcgatggcgcgtattggcgtgatctcttcgattcgcgtgttggtaaaagcaca
tggccttatggatcgggtgtttggtcgaagaaagagtgggttcttcctgagatcgatgac
gacgacatcgtttcagcttttgaaggaaactcgaatctgttctgggcagagagatttggt
aagcagtttctaggtatgaatgatctgtgggtgaaacactgtgggattagtcatacagga
agtttcaaggatcttggaatgactgttttggttagtcaagttaatcgtctgagaaagatg
aaacgacctgtggttggtgtcggatgtgcttccaccggagatacttctgctgctctatct
gcttactgcgcctccgctggaatcccatcgattgtgtttttaccggcgaacaagatctct
atggctcagctggttcagccgatagctaatggtgcgtttgttttgagtattgacactgat
tttgatgggtgtatgaagctgattagagagataactgcggaattgccgatttatttggcg
aattcgttgaatagtttgaggttagaagggcagaaaactgcagctattgagattttgcag
cagtttgattggcaagttcctgattgggtgattgttcctggaggtaacctaggaaacatc
tatgccttttacaaagggtttaagatgtgtcaagaactgggacttgtcgataggatcccg
aggatggtctgtgcacaagcagctaatgctaatcctctttacttgcactacaagtctggt
tggaaggacttcaagcccatgactgcaagtaccactttcgcctctgcgattcagatcggt
gaccctgtctccatcgatagagctgtgtacgctctcaagaagtgcaatggtattgtagaa
gaagccacagaggaggagctgatggatgcgatggctcaagcggattcgacaggaatgttt
atctgtcctcatacaggtgttgctctaactgctctgttcaagctgaggaatcaaggagtg
attgcaccgactgatcgaactgtggtagtgagtactgctcatgggttgaagtttactcag
tctaagatagattatcactccaatgccatccctgacatggcttgcagattctccaatcct
cctgttgatgtgaaagcagatttcggagctgtcatggatgttctcaagagttacttagga
agtaatacacttacgtcataa

DBGET integrated database retrieval system