KEGG   Arabidopsis thaliana (thale cress): AT4G30110
Entry
AT4G30110         CDS       T00041                                 

Symbol
HMA2
Name
(RefSeq) heavy metal atpase 2
  KO
K01534  Zn2+/Cd2+-exporting ATPase [EC:7.2.2.12 7.2.2.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT4G30110 (HMA2)
Enzymes [BR:ath01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.12  P-type Zn2+ transporter
     AT4G30110 (HMA2)
    7.2.2.21  Cd2+-exporting ATPase
     AT4G30110 (HMA2)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase Hydrolase_3 HAD_2
Other DBs
NCBI-GeneID: 829134
NCBI-ProteinID: NP_001320088
TAIR: AT4G30110
UniProt: Q9SZW4
Position
4:complement(14720062..14725311)
AA seq 951 aa
MASKKMTKSYFDVLGICCTSEVPLIENILNSMDGVKEFSVIVPSRTVIVVHDTLILSQFQ
IVKALNQAQLEANVRVTGETNFKNKWPSPFAVVSGILLLLSFFKYLYSPFRWLAVAAVVA
GIYPILAKAVASLARFRIDINILVVVTVGATIGMQDYTEAAVVVFLFTIAEWLQSRASYK
ASAVMQSLMSLAPQKAVIAETGEEVEVDELKTNTVIAVKAGETIPIDGVVVDGNCEVDEK
TLTGEAFPVPKLKDSTVWAGTINLNGYITVNTTALAEDCVVAKMAKLVEEAQNSKTETQR
FIDKCSKYYTPAIILISICFVAIPFALKVHNLKHWVHLALVVLVSACPCGLILSTPVATF
CALTKAATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFQSLSEDISLQSLLY
WVSSTESKSSHPMAAAVVDYARSVSVEPKPEAVEDYQNFPGEGIYGKIDGKEVYIGNKRI
ASRAGCLSVPDIDVDTKGGKTIGYVYVGETLAGVFNLSDACRSGVAQAMKELKSLGIKIA
MLTGDNHAAAMHAQEQLGNAMDIVRAELLPEDKSEIIKQLKREEGPTAMVGDGLNDAPAL
ATADIGISMGVSGSALATETGNIILMSNDIRRIPQAIKLAKRAKRKVVENVVISITMKGA
ILALAFAGHPLIWAAVLADVGTCLLVILNSMLLLSDKHKTGNKCYRESSSSSVLIAEKLE
GDAAGDMEAGLLPKISDKHCKPGCCGTKTQEKAMKPAKASSDHSHSGCCETKQKDNVTVV
KKSCCAEPVDLGHGHDSGCCGDKSQQPHQHEVQVQQSCHNKPSGLDSGCCGGKSQQPHQH
ELQQSCHDKPSGLDIGTGPKHEGSSTLVNLEGDAKEELKVLVNGFCSSPADLAITSLKVK
SDSHCKSNCSSRERCHHGSNCCRSYAKESCSHDHHHTRAHGVGTLKEIVIE
NT seq 2856 nt   +upstreamnt  +downstreamnt
atggcgtcgaagaagatgaccaagagttacttcgatgttcttggaatttgctgtacatcg
gaggttccgttgatcgagaatattctcaattccatggacggtgttaaagaattctctgtt
attgttccgtcaagaaccgtcatcgtcgtccacgacactctcatcctctcgcagttccaa
atcgttaaagcactgaaccaagcacagttagaagcaaatgtgagggtaaccggagaaacc
aatttcaagaataaatggccaagtccctttgcggtggtttccggcatacttctcctcctc
tccttcttcaaatacctttactctcccttccgttggctcgctgtcgcagccgttgtcgct
ggcatttatccgatattagccaaagctgtagcatctcttgcaaggtttagaatcgacatc
aacattcttgttgttgtaaccgtgggagcaacaattggcatgcaagattacacagaagct
gcagtagttgtcttcttgttcacaatcgctgaatggctccaatctagagctagctataag
gcaagtgcagtgatgcagtctttgatgagtttagctccacaaaaggccgtgattgcagag
actggagaagaagttgaagtggatgaactcaagactaacacagttatagctgtcaaagct
ggtgaaaccataccaattgatggagttgttgttgatggaaactgtgaagttgatgagaaa
actttgaccggtgaagcattccccgtgcctaaactgaaagattcgacggtttgggctgga
accatcaatctaaatggttacataactgtgaacaccactgctctagctgaggattgcgtg
gttgcgaagatggcaaaacttgtagaagaagctcagaacagcaaaaccgaaactcagaga
tttatagataaatgttccaagtactatactccagcgatcatcctgatatcaatctgtttt
gtggctatcccatttgcattgaaggttcacaacctgaaacattgggttcacttagcacta
gttgtgttagtaagtgcttgtccttgtggacttatcctctccacaccagtagccactttc
tgtgcactcacaaaggcagccacatcaggacttttgatcaaaggagctgattaccttgaa
accttagccaagatcaagattgttgcttttgataaaaccgggactatcactagaggtgag
ttcatcgtcatggatttccagtcactttctgaagatataagcctgcagagtctgctttac
tgggtatcaagcactgagagcaagtcaagccatccaatggctgctgcagttgtggactat
gcaagatctgtctctgttgaacctaagcctgaagcggtcgaagactaccagaactttcca
ggagaagggatttatgggaagattgatggtaaagaagtctatatcggtaacaaaaggatt
gcttctagagctgggtgtttatcagttccagatattgatgttgatactaaaggaggaaag
acaattggatatgtatatgttggagaaacactagctggtgttttcaatctctcagatgct
tgtagatctggtgtagctcaagccatgaaagaactgaaatcgttgggaattaagattgca
atgcttaccggagataatcatgccgctgcaatgcatgctcaagaacagctaggaaatgct
atggatattgttagagcagagcttcttccagaagataaatctgaaatcataaaacagtta
aagagagaagaagggccaacggctatggtaggggacgggttgaatgatgcaccagcttta
gctacagcggatattggtatctcaatgggtgtttccggctctgcacttgcaacagagact
ggtaatataattctgatgtccaatgatatcagaagaataccgcaggcgataaagcttgca
aaaagagcgaaaaggaaagtggtggagaatgtggtcatatcaatcactatgaaaggagct
attcttgcattggcatttgctggtcatccgctgatttgggcagctgttcttgcagatgta
ggaacttgtctgcttgtgatccttaatagcatgttgttgctcagtgataaacataaaact
ggaaacaaatgttatagggagtcttcttcttcctcggttttaatcgcggagaaacttgaa
ggtgatgctgctggggacatggaagcaggcttattaccaaagatcagtgataagcattgc
aagccgggctgttgtggaacgaagactcaagagaaagcgatgaaaccagctaaagccagt
tcggaccatagtcactctggttgttgtgagacgaaacagaaagacaatgtaacggttgtg
aaaaagagctgttgtgcagaacctgttgatttaggacatggccatgactcagggtgttgt
ggtgacaagagtcaacaaccacaccaacacgaggtgcaagtgcaacaaagctgtcataac
aagccatctggcctggactcagggtgttgtggtggcaagagtcaacagccacaccaacac
gagttgcaacaaagctgtcatgacaagccatctggcctggacattggaactggcccaaaa
cacgaaggttcttcaacattggtcaatctggagggggatgcgaaagaggaactgaaagtc
ttggtcaatggtttttgttcaagtcctgctgatctcgcgataactagcttgaaagtgaag
agcgatagccattgcaagtctaactgtagcagcagagagaggtgccaccatggcagcaac
tgttgtaggagctacgctaaagagagttgcagtcacgatcaccaccacacaagggctcat
ggcgttggaaccttgaaagagattgtgattgaatag

DBGET integrated database retrieval system