KEGG   Arabidopsis thaliana (thale cress): AT4G30920
Entry
AT4G30920         CDS       T00041                                 
Symbol
LAP2
Name
(RefSeq) Cytosol aminopeptidase family protein
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00480  Glutathione metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT4G30920 (LAP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT4G30920 (LAP2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     AT4G30920 (LAP2)
Peptidases and inhibitors [BR:ath01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   AT4G30920 (LAP2)
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N PDZ_6
Other DBs
NCBI-GeneID: 829216
NCBI-ProteinID: NP_194821
TAIR: AT4G30920
UniProt: Q944P7 A0A654FUF0
Position
4:complement(15046457..15049438)
AA seq 583 aa
MAVTLVTSFASSSSRFHFRSFSSSPSSLSSCFVRFQFPSRLRLAFAVTPLYSSSRAMAHT
ISHATLGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMAKDVNSKFENPILKK
LDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSLGEAV
AAAAKASQASSVAVVLASSESVSNESKLCSASAIASGTVLGLFEDSRYKSESKKPSLKSV
DIIGFGSGPELEKKLKYAEHVSYGVIFGKELVNSPANVLTPAVLAEEALNLASMYSDVMT
ANILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFDSGGY
NIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGMRPGD
VLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSMAGIY
TPSDKLAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALFLKQ
FVSEDVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNHSSS
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggccgtcactttggtaacgtccttcgcttcttcgtcttctcgcttccatttccgctca
ttctcctcttctccgtcgtctctctcctcttgtttcgtccgattccagttcccctctcgc
cttagactcgcttttgccgtcacgcctctctactcttcttctagagccatggctcataca
atctcacacgctactctcggcctcactcaggctaactccgtcgatcatcctaagatctca
ttttcggggaaggagatcgacgtgacggaatggaaaggtgatatactcgctgttggagtg
acggagaaagacatggctaaggatgtgaactccaagttcgaaaacccgattctgaagaag
cttgatgctcacttgggtggacttttagctgatgtctcgtctgaggaagatttttctggg
aaacctggtcagtcgacagttcttaggcttccgggtcttgggtctaagcgagttggtttg
attggtcttggaaaatctgcttcaactccttcggcttttcagagtctcggtgaggctgtt
gctgcagctgctaaagcttctcaagctagcagtgttgcagttgttctcgcctcctctgag
agtgtttctaatgaatctaagctctgttctgcgtcagctatagcttcaggcacagtgctt
ggtttgtttgaagacagccggtataagtctgagtcgaagaaaccatcactcaaatctgta
gatatcattggctttggctctggacctgaactagagaagaagcttaagtatgctgaacat
gtttcttatggcgttattttcgggaaagaactcgttaattctccagccaatgttctcact
cctgccgtactagctgaggaagccttgaatctggcttccatgtacagtgatgtcatgact
gccaacatcttgaacgaggagcaatgcaaagagttgaagatgggttcatatcttgctgta
gctgctgcttcagctaatccacctcatttcatacatcttatctacaaaccttctagtggc
cctgttaaaacaaaacttgctcttgttggaaaaggattgacatttgacagcggtggctac
aacattaaaaccgggcctggctgcttaattgagctcatgaaattcgatatgggaggttca
gctgctgttcttggcgctgcaaaagccattggtcaaattaagcctccaggtgttgaggtg
cactttattgtcgcagcttgtgagaatatgataagtggtactggaatgagacctggagat
gtcctcacagcctcaaacggaaagacgattgaggtcaacaacaccgatgctgaaggtcga
ctaacacttgcagatgctttagtttatgcttgcaaccagggtgtcgataaggttgttgac
cttgcaacattgactggggcttgtattattgctcttggaacatcaatggcaggcatatat
acacctagtgataagcttgcaaaggaggtgattgctgcatcagagaggagtggagagaag
ttatggagaatgcctatggaagagagttactgggagatgatgaagtcaggtgttgcagat
atggttaacactggaggccgtgcaggtggatccattaccgcggctcttttcttgaaacag
tttgtgagcgaggatgttgagtggatgcacatagatatggctggaccagtgtggaacgag
aagaagaaagctgcaactgggtttggagttgcgacactagttgagtgggtacagaaccat
tcttcttcttaa

DBGET integrated database retrieval system