KEGG   Arabidopsis thaliana (thale cress): AT4G31550Help
Entry
AT4G31550         CDS       T00041                                 

Gene name
WRKY11
Definition
(RefSeq) WRKY DNA-binding protein 11
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: WRKY Plant_zn_clust
Motif
Other DBs
NCBI-GeneID: 829282
NCBI-ProteinID: NP_849559
MIPS: AT4G31550.1
TAIR: AT4G31550
Araport: AT4G31550
UniProt: Q9SV15
Position
4
AA seq 325 aa AA seqDB search
MAVDLMRFPKIDDQTAIQEAASQGLQSMEHLIRVLSNRPEQQHNVDCSEITDFTVSKFKT
VISLLNRTGHARFRRGPVHSTSSAASQKLQSQIVKNTQPEAPIVRTTTNHPQIVPPPSSV
TLDFSKPSIFGTKAKSAELEFSKENFSVSLNSSFMSSAITGDGSVSNGKIFLASAPLQPV
NSSGKPPLAGHPYRKRCLEHEHSESFSGKVSGSAYGKCHCKKSRKNRMKRTVRVPAISAK
IADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDPAMLIVTYEGE
HRHNQSAMQENISSSGINDLVFASA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgatctaatgcgtttccctaagatagatgatcaaacggctattcaggaagct
gcatcgcaaggtttacaaagtatggaacatctgatccgtgtcctctctaaccgtcccgaa
caacaacacaacgttgactgctccgagatcactgacttcaccgtttctaaattcaaaacc
gtcatttctctccttaaccgtactggtcacgctcggttcagacgcggaccggttcactcc
acttcctctgccgcatctcagaaactacagagtcagatcgttaaaaatactcaacctgag
gctccgatagtgagaacaactacgaatcaccctcaaatcgttcctccaccgtctagtgta
acactcgatttctctaaaccaagcatcttcggcaccaaagctaagagcgccgagctggaa
ttctccaaagaaaacttcagtgtttctttaaactcctcattcatgtcgtcggcgataacc
ggagacggcagcgtctccaatggaaaaatcttccttgcttctgctccgttgcagcctgtt
aactcttccggaaaaccaccgttggctggtcatccttacagaaagagatgtctcgagcat
gagcactcagagagtttctccggaaaagtctccggctccgcctacggaaagtgccattgc
aagaaaagcaggaaaaatcggatgaagagaaccgtgagagtaccggcgataagtgcaaag
atcgccgatattccaccggacgaatattcgtggaggaagtacggacaaaaaccgatcaag
ggctcaccacacccacgtggttactacaagtgcagtacattcagaggatgtccagcgagg
aaacacgtggaacgagcattagatgatccagcgatgcttattgtgacatacgaaggagag
caccgtcataaccaatccgcgatgcaggagaatatttcttcttcaggcattaatgattta
gtgtttgcctcggcttga

DBGET integrated database retrieval system